BLASTX nr result
ID: Catharanthus23_contig00009571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009571 (1364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ22510.1| hypothetical protein PRUPE_ppa025777mg, partial [... 46 1e-09 gb|EMJ14584.1| hypothetical protein PRUPE_ppa026473mg [Prunus pe... 46 1e-09 gb|EMJ20323.1| hypothetical protein PRUPE_ppa015847mg, partial [... 45 5e-09 gb|EMJ02729.1| hypothetical protein PRUPE_ppa016152mg, partial [... 48 6e-09 gb|EMJ28015.1| hypothetical protein PRUPE_ppa017701mg [Prunus pe... 43 3e-08 >gb|EMJ22510.1| hypothetical protein PRUPE_ppa025777mg, partial [Prunus persica] Length = 697 Score = 45.8 bits (107), Expect(2) = 1e-09 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = +3 Query: 1086 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 1217 EF+NFES+ S++ Q+YLDE + R +LNVLD+WK N++++ Sbjct: 556 EFDNFESEEFTTSAQKTQLQLYLDEPKIDRKTKLNVLDFWKVNQFRY 602 Score = 45.1 bits (105), Expect(2) = 1e-09 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +1 Query: 1249 SFPITTIALEFAFS---RILNPYQSKILPKNVEARICTRD 1359 S PI+T+A E AFS R+L+ Y+S + P+NVEA +CTRD Sbjct: 614 SIPISTVASESAFSVGGRVLDQYRSALKPENVEALVCTRD 653 >gb|EMJ14584.1| hypothetical protein PRUPE_ppa026473mg [Prunus persica] Length = 696 Score = 45.8 bits (107), Expect(2) = 1e-09 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = +3 Query: 1086 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 1217 EF+NFES+ S++ Q+YLDE + R +LNVLD+WK N++++ Sbjct: 555 EFDNFESEEFTTSAQKTQLQLYLDEPKIDRKTKLNVLDFWKVNQFRY 601 Score = 45.1 bits (105), Expect(2) = 1e-09 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = +1 Query: 1249 SFPITTIALEFAFS---RILNPYQSKILPKNVEARICTRD 1359 S PI+T+A E AFS R+L+ Y+S + P+NVEA +CTRD Sbjct: 613 SIPISTVASESAFSVGGRVLDQYRSALKPENVEALVCTRD 652 >gb|EMJ20323.1| hypothetical protein PRUPE_ppa015847mg, partial [Prunus persica] Length = 458 Score = 45.1 bits (105), Expect(2) = 5e-09 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = +3 Query: 1086 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 1217 EF+NFES+ S++ Q+YLDE + R +LNVLD+WK N++++ Sbjct: 317 EFDNFESEEITTSAQKTQLQLYLDEPKIDRKTKLNVLDFWKVNQFQY 363 Score = 43.9 bits (102), Expect(2) = 5e-09 Identities = 23/40 (57%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +1 Query: 1249 SFPITTIALEFAFS---RILNPYQSKILPKNVEARICTRD 1359 S PI+T+A E AFS R+L+ Y S + P+NVEA ICTRD Sbjct: 375 SIPISTVASESAFSVGGRVLDQYCSALKPENVEALICTRD 414 >gb|EMJ02729.1| hypothetical protein PRUPE_ppa016152mg, partial [Prunus persica] Length = 613 Score = 47.8 bits (112), Expect(2) = 6e-09 Identities = 22/47 (46%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = +3 Query: 1086 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 1217 EF+NFES+ S++ Q+YLDEA + R +LNVLD+WK N++++ Sbjct: 472 EFDNFESEEFTTSAQKTQLQLYLDEAKIDRKTKLNVLDFWKVNQFRY 518 Score = 40.8 bits (94), Expect(2) = 6e-09 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +1 Query: 1249 SFPITTIALEFAFS---RILNPYQSKILPKNVEARICTRD 1359 S PI+T+A E FS R+L+ Y+S + P+NVEA +CT D Sbjct: 530 SIPISTVASESTFSVDGRVLDQYRSALKPENVEALVCTLD 569 >gb|EMJ28015.1| hypothetical protein PRUPE_ppa017701mg [Prunus persica] Length = 567 Score = 43.1 bits (100), Expect(2) = 3e-08 Identities = 20/52 (38%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = +3 Query: 1071 VEKS*EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 1217 + K+ EF+NFES+ S++ Q+YL+E + R +LNVL++WK N++++ Sbjct: 440 LRKAKEFDNFESEEFTTSAQKTQLQLYLNEPKIDRKTKLNVLNFWKVNQFRY 491 Score = 43.1 bits (100), Expect(2) = 3e-08 Identities = 21/40 (52%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +1 Query: 1249 SFPITTIALEFAFS---RILNPYQSKILPKNVEARICTRD 1359 S PI+T+A E AFS R+L+ Y S + P+NVEA +CT D Sbjct: 503 SIPISTVAYESAFSVGGRVLDQYHSALKPENVEALVCTHD 542