BLASTX nr result
ID: Catharanthus23_contig00009458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009458 (621 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33214.1| hypothetical protein L484_011191 [Morus notabilis] 59 8e-07 gb|EOY34258.1| Uncharacterized protein TCM_041992 [Theobroma cacao] 59 8e-07 ref|XP_002530241.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 gb|EOY34257.1| Uncharacterized protein TCM_041991 [Theobroma cacao] 57 3e-06 >gb|EXC33214.1| hypothetical protein L484_011191 [Morus notabilis] Length = 81 Score = 59.3 bits (142), Expect = 8e-07 Identities = 36/79 (45%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = +3 Query: 81 MEFKSPKQNAKSIAEIPPRRGDIKVRIFKSI---VKSAVEILTGSKTKRRRNRGGSLTSS 251 ME SPK N +S PP+RG IK+RI KS+ V S+V + G+ + G SL+ Sbjct: 1 MENLSPKLNGQSKRNPPPKRGQIKLRIIKSLITSVASSVGAIGGTTERSDGENGESLSPI 60 Query: 252 ASTTPHETPSGYTSDADFD 308 S P TPSGYTSDA D Sbjct: 61 NSPAPAATPSGYTSDARSD 79 >gb|EOY34258.1| Uncharacterized protein TCM_041992 [Theobroma cacao] Length = 73 Score = 59.3 bits (142), Expect = 8e-07 Identities = 35/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Frame = +3 Query: 96 PKQNAKSIAEIPPRRGDIKVRIFKSIVKSAVEIL-TGSKTKR-RRNRGGSLTSSASTTPH 269 P+QN +PP+RG I +RI K + KSA L TGS +R RR RGG L+SS++T H Sbjct: 2 PQQNFP----LPPKRGRITIRIIKGLWKSAANFLSTGSGRRRARRERGGGLSSSSTTPGH 57 Query: 270 ETPSGYTSDADFD 308 TP Y SD D Sbjct: 58 ATPIDYNSDGSLD 70 >ref|XP_002530241.1| conserved hypothetical protein [Ricinus communis] gi|223530245|gb|EEF32147.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/78 (43%), Positives = 45/78 (57%), Gaps = 2/78 (2%) Frame = +3 Query: 81 MEFKSPK--QNAKSIAEIPPRRGDIKVRIFKSIVKSAVEILTGSKTKRRRNRGGSLTSSA 254 ME K PK ++ + +PPRRG +KVRI K +VKS V G + + + GG T+S Sbjct: 1 MELKPPKPTRHHRQPQTLPPRRGQVKVRIIKEVVKS-VSAFFGKRGRPSGDGGGGFTTSN 59 Query: 255 STTPHETPSGYTSDADFD 308 S+TP SGY SDA D Sbjct: 60 SSTPATISSGYNSDAPSD 77 >gb|EOY34257.1| Uncharacterized protein TCM_041991 [Theobroma cacao] Length = 73 Score = 57.4 bits (137), Expect = 3e-06 Identities = 31/73 (42%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +3 Query: 81 MEFKSPKQNAKSIAEIPPRRGDIKVRIFKSIVKSAVEILTGSKT-KRRRNRGGSLTSSAS 257 MEF + K +PPRRG +K+RIFKS +KS I + +K R+R G SS S Sbjct: 1 MEFNASSNTKKQKQTLPPRRGQVKIRIFKSFLKSVSSIASMAKAMPRKREESGPDVSSNS 60 Query: 258 TTPHETPSGYTSD 296 T TP+ Y SD Sbjct: 61 TPAAPTPTSYNSD 73