BLASTX nr result
ID: Catharanthus23_contig00009320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009320 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384165.1| hypothetical protein POPTR_0004s08880g [Popu... 56 6e-06 ref|XP_002337165.1| predicted protein [Populus trichocarpa] 56 6e-06 ref|XP_002317327.2| hypothetical protein POPTR_0011s08735g [Popu... 55 1e-05 ref|XP_006389161.1| hypothetical protein POPTR_0040s00204g [Popu... 55 1e-05 >ref|XP_006384165.1| hypothetical protein POPTR_0004s08880g [Populus trichocarpa] gi|550340628|gb|ERP61962.1| hypothetical protein POPTR_0004s08880g [Populus trichocarpa] Length = 520 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/64 (43%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +1 Query: 313 SSKPNCRQRTDLTWKYCA*MENSN---KKKVLCCEFSRKTFDGGGINRIKQYLVGAKGNI 483 S R RTDL W +C + KK L C + K F GGGINR KQ+L+GAKG + Sbjct: 24 SMSSGSRGRTDLAWGHCREAPELSVGCKKTKLVCLYCAKVFAGGGINRFKQHLIGAKGEV 83 Query: 484 VSCK 495 C+ Sbjct: 84 EQCR 87 >ref|XP_002337165.1| predicted protein [Populus trichocarpa] Length = 93 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/64 (43%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +1 Query: 313 SSKPNCRQRTDLTWKYCA*MENSN---KKKVLCCEFSRKTFDGGGINRIKQYLVGAKGNI 483 S R RTDL W +C + KK L C + K F GGGINR+KQ+L GAKG + Sbjct: 24 SMSSGSRGRTDLAWGHCREAPELSVGCKKTKLVCLYCAKVFTGGGINRLKQHLAGAKGEV 83 Query: 484 VSCK 495 C+ Sbjct: 84 EQCR 87 >ref|XP_002317327.2| hypothetical protein POPTR_0011s08735g [Populus trichocarpa] gi|550327968|gb|EEE97939.2| hypothetical protein POPTR_0011s08735g [Populus trichocarpa] Length = 619 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/63 (44%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +1 Query: 313 SSKPNCRQRTDLTWKYCA*---MENSNKKKVLCCEFSRKTFDGGGINRIKQYLVGAKGNI 483 S+ R +TDL W +C + KK L C + K F GGGINR KQYL GAKG + Sbjct: 26 STSSGIRGKTDLAWGHCREALELSVGCKKTKLVCLYCAKVFAGGGINRFKQYLAGAKGEV 85 Query: 484 VSC 492 C Sbjct: 86 EQC 88 >ref|XP_006389161.1| hypothetical protein POPTR_0040s00204g [Populus trichocarpa] gi|550311826|gb|ERP48075.1| hypothetical protein POPTR_0040s00204g [Populus trichocarpa] Length = 275 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/63 (44%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +1 Query: 313 SSKPNCRQRTDLTWKYCA*---MENSNKKKVLCCEFSRKTFDGGGINRIKQYLVGAKGNI 483 S+ R +TDL W +C + KK L C + K F GGGINR KQYL GAKG + Sbjct: 26 STSSGIRGKTDLAWGHCREALELSVGCKKTKLVCLYCAKVFAGGGINRFKQYLAGAKGEV 85 Query: 484 VSC 492 C Sbjct: 86 EQC 88