BLASTX nr result
ID: Catharanthus23_contig00009083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009083 (1182 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW21410.1| hypothetical protein PHAVU_005G068500g [Phaseolus... 58 9e-06 >gb|ESW21410.1| hypothetical protein PHAVU_005G068500g [Phaseolus vulgaris] Length = 332 Score = 57.8 bits (138), Expect = 9e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 1182 AHQEALRKEIERLRQIYHEQNMKKMSNKGTNEASQSPT 1069 AHQEAL+KEIERLRQIYH+QN++KMSN N +PT Sbjct: 257 AHQEALKKEIERLRQIYHQQNLQKMSNTVNNNLQTAPT 294