BLASTX nr result
ID: Catharanthus23_contig00008425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00008425 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379920.1| hypothetical protein POPTR_0008s17410g [Popu... 56 6e-06 >ref|XP_006379920.1| hypothetical protein POPTR_0008s17410g [Populus trichocarpa] gi|550333292|gb|ERP57717.1| hypothetical protein POPTR_0008s17410g [Populus trichocarpa] Length = 94 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +3 Query: 93 KKMKAMPVDFFADLEDHGTTVAMDVDDAEALEIFG 197 ++M+ M VDFFAD+ED G+TVAMDVDD +ALE+FG Sbjct: 31 REMRPMQVDFFADMEDQGSTVAMDVDDVDALEMFG 65