BLASTX nr result
ID: Catharanthus23_contig00007683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00007683 (1247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW35909.1| hypothetical protein PHAVU_L006100g [Phaseolus vu... 59 3e-06 >gb|ESW35909.1| hypothetical protein PHAVU_L006100g [Phaseolus vulgaris] Length = 1070 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/85 (37%), Positives = 46/85 (54%) Frame = -3 Query: 957 PYNSWTEVSSEVRDM*WGEFQKRYVYDAVSPIAKMKQAWESKVSARLRDSLGDALGANKR 778 PY+ + +S E + W EF+ R + A ++ + +ESKV RL D L A R Sbjct: 782 PYHHYEAMSEEAKLRWWTEFKTRVTW-APHDEWQIIKVYESKVRKRLCDMLSKARVKGSR 840 Query: 777 PPWIEEKFWDDLLKYWDSSKYRTLS 703 P WI E+ W +LL YWDS K++ S Sbjct: 841 PTWIGEEAWGELLNYWDSQKFKDKS 865