BLASTX nr result
ID: Catharanthus23_contig00006563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00006563 (1206 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEF32085.1| ent-kaurenoic acid oxidase [Castanea mollissima] 70 2e-09 gb|EOY24444.1| Cytochrome P450, family 88, subfamily A, polypept... 70 2e-09 gb|EOY24443.1| Cytochrome P450, family 88, subfamily A, polypept... 70 2e-09 gb|EOY24442.1| Cytochrome P450, family 88, subfamily A, polypept... 70 2e-09 gb|EXB70679.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis] 69 4e-09 ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vit... 69 4e-09 ref|XP_002321248.2| ent-kaurenoic acid oxidase family protein [P... 69 5e-09 gb|EOY17517.1| Ent-kaurenoic acid oxidase 1 isoform 2 [Theobroma... 66 2e-08 gb|EOY17516.1| Cytochrome P450, family 88, subfamily A, polypept... 66 2e-08 ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinu... 65 6e-08 ref|XP_004308741.1| PREDICTED: ent-kaurenoic acid oxidase 1-like... 64 9e-08 ref|XP_006410376.1| hypothetical protein EUTSA_v10016575mg [Eutr... 64 1e-07 gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum] 64 1e-07 ref|XP_004307312.1| PREDICTED: ent-kaurenoic acid oxidase 1-like... 63 2e-07 ref|XP_002319447.1| ent-kaurenoic acid oxidase family protein [P... 61 1e-06 gb|AGF25266.1| ent-kaurenoic acid oxidase [Pyrus communis] 60 1e-06 gb|EMJ21046.1| hypothetical protein PRUPE_ppa027023mg [Prunus pe... 60 2e-06 ref|XP_003546291.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Gly... 60 2e-06 gb|EMJ19129.1| hypothetical protein PRUPE_ppa004910mg [Prunus pe... 60 2e-06 gb|EMJ19128.1| hypothetical protein PRUPE_ppa004901mg [Prunus pe... 60 2e-06 >gb|AEF32085.1| ent-kaurenoic acid oxidase [Castanea mollissima] Length = 492 Score = 70.1 bits (170), Expect = 2e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 MELG IC V + IFG + LKW++ + N W +E +LGEK++SLPPGDLG PF Sbjct: 1 MELGPICNVLLCIFGVLVVLKWVVKNANWWLYETQLGEKQYSLPPGDLGWPF 52 >gb|EOY24444.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 3 [Theobroma cacao] gi|508777189|gb|EOY24445.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 3 [Theobroma cacao] Length = 361 Score = 69.7 bits (169), Expect = 2e-09 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME+GS+ MV +AI G ++KW+L +N W +E++LG+K+FSLPPGDLG PF Sbjct: 1 MEIGSMWMVLLAILAGLASVKWVLERVNWWLYESQLGDKQFSLPPGDLGWPF 52 >gb|EOY24443.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 2 [Theobroma cacao] Length = 396 Score = 69.7 bits (169), Expect = 2e-09 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME+GS+ MV +AI G ++KW+L +N W +E++LG+K+FSLPPGDLG PF Sbjct: 1 MEIGSMWMVLLAILAGLASVKWVLERVNWWLYESQLGDKQFSLPPGDLGWPF 52 >gb|EOY24442.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 1 [Theobroma cacao] Length = 499 Score = 69.7 bits (169), Expect = 2e-09 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME+GS+ MV +AI G ++KW+L +N W +E++LG+K+FSLPPGDLG PF Sbjct: 1 MEIGSMWMVLLAILAGLASVKWVLERVNWWLYESQLGDKQFSLPPGDLGWPF 52 >gb|EXB70679.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis] Length = 493 Score = 68.9 bits (167), Expect = 4e-09 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 +E GS+ + ++ G F+ LKWLL ++N W +E KLGEK++SLPPGDLG PF Sbjct: 3 LEFGSVVLALLSSLGCFVVLKWLLRNVNWWLYETKLGEKKYSLPPGDLGWPF 54 >ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vitis vinifera] Length = 492 Score = 68.9 bits (167), Expect = 4e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLP 1201 MELG I + F AI GG + +KW+L N W +E KLGEKR+SLPPGDLG P Sbjct: 1 MELGMIWVAFGAILGGVLGVKWVLRRANSWVYEVKLGEKRYSLPPGDLGWP 51 >ref|XP_002321248.2| ent-kaurenoic acid oxidase family protein [Populus trichocarpa] gi|550324438|gb|EEE99563.2| ent-kaurenoic acid oxidase family protein [Populus trichocarpa] Length = 535 Score = 68.6 bits (166), Expect = 5e-09 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME GSI +V IFGG KW+L +N W +EA+LGEK++SLPPGDLG PF Sbjct: 1 MESGSIWVVLAVIFGGLGVGKWILKKVNWWLYEAQLGEKQYSLPPGDLGWPF 52 >gb|EOY17517.1| Ent-kaurenoic acid oxidase 1 isoform 2 [Theobroma cacao] Length = 539 Score = 66.2 bits (160), Expect = 2e-08 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME+GS+ MV +AI G ++KW+L +N W +E++LG+ ++SLPPGDLG PF Sbjct: 44 MEMGSMWMVLLAILAGLASVKWVLERVNWWLYESQLGDMQYSLPPGDLGWPF 95 >gb|EOY17516.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 1 [Theobroma cacao] Length = 496 Score = 66.2 bits (160), Expect = 2e-08 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME+GS+ MV +AI G ++KW+L +N W +E++LG+ ++SLPPGDLG PF Sbjct: 1 MEMGSMWMVLLAILAGLASVKWVLERVNWWLYESQLGDMQYSLPPGDLGWPF 52 >ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis] gi|223534199|gb|EEF35915.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis] Length = 492 Score = 65.1 bits (157), Expect = 6e-08 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 ME+G + +V + I GGF LKW+L +N W +E +LGE ++SLPPGDLG PF Sbjct: 1 MEMGFVWVVLIWISGGFWCLKWILKRVNCWLYENQLGEMQYSLPPGDLGWPF 52 >ref|XP_004308741.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca subsp. vesca] Length = 493 Score = 64.3 bits (155), Expect = 9e-08 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +2 Query: 1049 MELGSICMVFM---AIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 MELGS+ MV + + G F+ LKWLL ++NRW +E LG K+ LPPGDLGLPF Sbjct: 1 MELGSMWMVVLCSTSFVGVFVTLKWLLMNVNRWLYETPLGVKKHCLPPGDLGLPF 55 >ref|XP_006410376.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum] gi|567211540|ref|XP_006410377.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum] gi|557111545|gb|ESQ51829.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum] gi|557111546|gb|ESQ51830.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum] Length = 489 Score = 63.9 bits (154), Expect = 1e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +2 Query: 1052 ELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 E GSI M F I G LKW+L +N WR+E+KLGEK+ LPPGDLG PF Sbjct: 3 ETGSILMWFPWIVLGLFVLKWVLKRVNVWRYESKLGEKKLYLPPGDLGWPF 53 >gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum] Length = 488 Score = 63.9 bits (154), Expect = 1e-07 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = +2 Query: 1043 LIMELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 +I+E+GS+ +V MAI G + L+ +L ++N W +E+KLG K++SLPPGD+G PF Sbjct: 1 MILEMGSMWVVLMAIGGALLVLRSILKNVNWWLYESKLGVKQYSLPPGDMGWPF 54 >ref|XP_004307312.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca subsp. vesca] Length = 503 Score = 63.2 bits (152), Expect = 2e-07 Identities = 29/61 (47%), Positives = 42/61 (68%), Gaps = 3/61 (4%) Frame = +2 Query: 1031 ITNLLIMELGSICMVFM---AIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLP 1201 + L++ LGS+ + + G +ALKW+L ++N W +E KLGEK++SLPPGDLGLP Sbjct: 6 VEGLVLGNLGSMWAAILGTSSFVGVLLALKWVLENVNWWLYETKLGEKQYSLPPGDLGLP 65 Query: 1202 F 1204 F Sbjct: 66 F 66 >ref|XP_002319447.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa] gi|222857823|gb|EEE95370.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa] Length = 490 Score = 60.8 bits (146), Expect = 1e-06 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +2 Query: 1049 MELGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 M LGSI +V + IF G +W+L +N W +EAKLG K+ SLPPGDLG PF Sbjct: 1 MGLGSIWVVLVVIFCGLGVGQWILKRVNWWLYEAKLGAKKDSLPPGDLGWPF 52 >gb|AGF25266.1| ent-kaurenoic acid oxidase [Pyrus communis] Length = 503 Score = 60.5 bits (145), Expect = 1e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 1055 LGSICMVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 L SI M+ ++ F G +A WL+ + NR +E +LGE+R+SLPPGDLGLPF Sbjct: 13 LASIWMLLLSSFVGLVAFWWLIKNANRLLYETQLGERRYSLPPGDLGLPF 62 >gb|EMJ21046.1| hypothetical protein PRUPE_ppa027023mg [Prunus persica] Length = 486 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +2 Query: 1070 MVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 MV + G +ALKWLL S N W +E LGEK++SLPPGDL PF Sbjct: 3 MVLLCSLGALVALKWLLQSANSWYYETPLGEKKYSLPPGDLSWPF 47 >ref|XP_003546291.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Glycine max] Length = 494 Score = 60.1 bits (144), Expect = 2e-06 Identities = 27/55 (49%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +2 Query: 1046 IMELGSICM--VFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 +ME+ S+CM V +AI G + L+ +L ++N W +E+KLG K++SLPPGD+G PF Sbjct: 1 MMEMDSMCMWVVLVAIAGALLVLRSMLKNVNWWLYESKLGVKQYSLPPGDMGWPF 55 >gb|EMJ19129.1| hypothetical protein PRUPE_ppa004910mg [Prunus persica] Length = 486 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 1070 MVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 +V + G +ALKWLL + N W +E LGEK++SLPPGDLG PF Sbjct: 3 VVLLCSLGALVALKWLLQNANSWYYETPLGEKKYSLPPGDLGWPF 47 >gb|EMJ19128.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica] Length = 486 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +2 Query: 1070 MVFMAIFGGFMALKWLLGSINRWRFEAKLGEKRFSLPPGDLGLPF 1204 MV + G +ALKWLL + N W +E LGEK+ SLPPGDLG PF Sbjct: 3 MVLLCSLGALVALKWLLQNANSWYYETPLGEKKHSLPPGDLGWPF 47