BLASTX nr result
ID: Catharanthus23_contig00006546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00006546 (208 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242987.1| PREDICTED: putative late blight resistance p... 61 1e-07 gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicu... 57 2e-06 ref|XP_006363648.1| PREDICTED: leucine-rich repeat and IQ domain... 57 3e-06 ref|XP_004231569.1| PREDICTED: putative late blight resistance p... 56 6e-06 >ref|XP_004242987.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like [Solanum lycopersicum] Length = 584 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = -3 Query: 170 VYRLLKVLDLRHIMLDKFPGKILELVHLRLLALWVDRYPDLPQAMFRLWNLETFIL 3 +Y+LL+VL + +I D FP ++L+LVHLR LAL V PD P+ + RLWNL+TFIL Sbjct: 231 LYKLLRVLHILNITFDCFPPQVLQLVHLRYLALAVYE-PDCPELISRLWNLQTFIL 285 >gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense] Length = 905 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/55 (50%), Positives = 40/55 (72%) Frame = -3 Query: 167 YRLLKVLDLRHIMLDKFPGKILELVHLRLLALWVDRYPDLPQAMFRLWNLETFIL 3 ++LLKVL+LRH +D FP +IL L+ LR L+L+ D+P + RLWNL+TFI+ Sbjct: 578 FKLLKVLELRHRQIDGFPREILSLIWLRYLSLFSYGNFDVPPEICRLWNLQTFIV 632 >ref|XP_006363648.1| PREDICTED: leucine-rich repeat and IQ domain-containing protein 4-like [Solanum tuberosum] Length = 190 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/58 (51%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = -3 Query: 167 YRLLKVLDLRHIMLDKFPGKILELVHLRLLALWVDRYP---DLPQAMFRLWNLETFIL 3 ++LLK+LDL H+ + FP +IL L+ LR LAL RYP D+P + RLWNL+TFI+ Sbjct: 104 FKLLKILDLAHMAIYSFPLQILSLIWLRYLAL---RYPENFDIPPEICRLWNLQTFIV 158 >ref|XP_004231569.1| PREDICTED: putative late blight resistance protein homolog R1B-13-like [Solanum lycopersicum] Length = 901 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = -3 Query: 167 YRLLKVLDLRHIMLDKFPGKILELVHLRLLALWVDRYPDLPQAMFRLWNLETFIL 3 ++LLK+LDL HI + FP +IL L+ LR LAL+ D+ + RLWNL+TFI+ Sbjct: 595 FKLLKILDLTHIRIYSFPLQILSLIWLRYLALFCSEIFDVTPEICRLWNLQTFIV 649