BLASTX nr result
ID: Catharanthus23_contig00006375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00006375 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305025.1| PREDICTED: uncharacterized protein LOC101305... 62 8e-08 gb|EXC31834.1| hypothetical protein L484_020662 [Morus notabilis] 61 2e-07 ref|XP_002319568.1| hypothetical protein POPTR_0013s02820g [Popu... 58 1e-06 ref|XP_004305023.1| PREDICTED: uncharacterized protein LOC101304... 55 7e-06 >ref|XP_004305025.1| PREDICTED: uncharacterized protein LOC101305287 [Fragaria vesca subsp. vesca] Length = 214 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 316 GENLNVLMMNLPVGAGVLSTFLFVLFPTTRRGIGYADL 203 G N++ L M LP+GAGVLSTFLF +FPTTRRGIGYAD+ Sbjct: 167 GINISELAMKLPLGAGVLSTFLFTIFPTTRRGIGYADI 204 >gb|EXC31834.1| hypothetical protein L484_020662 [Morus notabilis] Length = 196 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 316 GENLNVLMMNLPVGAGVLSTFLFVLFPTTRRGIGYADL 203 G N L MNLP+G+G LSTFLF +FPTTRRGIGYAD+ Sbjct: 155 GTEWNSLFMNLPLGSGALSTFLFTIFPTTRRGIGYADI 192 >ref|XP_002319568.1| hypothetical protein POPTR_0013s02820g [Populus trichocarpa] gi|222857944|gb|EEE95491.1| hypothetical protein POPTR_0013s02820g [Populus trichocarpa] Length = 200 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 316 GENLNVLMMNLPVGAGVLSTFLFVLFPTTRRGIGYAD 206 G N L+MNLP+GAG L++FLF+LFPT RRGIGYAD Sbjct: 150 GANEKALIMNLPLGAGFLASFLFMLFPTKRRGIGYAD 186 >ref|XP_004305023.1| PREDICTED: uncharacterized protein LOC101304693 [Fragaria vesca subsp. vesca] Length = 232 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -1 Query: 316 GENLNVLMMNLPVGAGVLSTFLFVLFPTTRRGIGY 212 G++LN +++NLP+GAG+ + FLF +FPTTRRGIGY Sbjct: 151 GDDLNEIIINLPLGAGIFACFLFTIFPTTRRGIGY 185