BLASTX nr result
ID: Catharanthus23_contig00003360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00003360 (750 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 69 2e-09 ref|XP_002335728.1| predicted protein [Populus trichocarpa] 57 5e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 68.9 bits (167), Expect = 2e-09 Identities = 43/82 (52%), Positives = 46/82 (56%), Gaps = 6/82 (7%) Frame = +2 Query: 2 KVDYLSIYFKASIIPSRTKHESFDSFGSPTQLLRKNLHIFL*M**AYPLFFVC------S 163 KVDY SI F+ SIIPSRTKHESFDSFGS QLL+ N HIF F+ C S Sbjct: 2 KVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIF---------FYECNEPIFSS 52 Query: 164 YFHXXXXXXXXXXSKYSEDSSD 229 F KYSEDSSD Sbjct: 53 LFIFQKDIETNVIPKYSEDSSD 74 >ref|XP_002335728.1| predicted protein [Populus trichocarpa] Length = 79 Score = 57.4 bits (137), Expect = 5e-06 Identities = 30/43 (69%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = +2 Query: 2 KVDYLSIYFKASIIPSRTKHESFDSFGSP---TQLLRKNLHIF 121 KVDYLSI+ K S+IPSRTKHESFDSFGS QLL N H+F Sbjct: 2 KVDYLSIHCKTSMIPSRTKHESFDSFGSHAQLVQLLMGNSHLF 44