BLASTX nr result
ID: Catharanthus23_contig00002203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00002203 (661 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66506.1| hypothetical protein VITISV_035499 [Vitis vinifera] 58 2e-06 gb|EPS70866.1| hypothetical protein M569_03894, partial [Genlise... 57 4e-06 ref|XP_004486396.1| PREDICTED: uncharacterized protein LOC101505... 57 6e-06 >emb|CAN66506.1| hypothetical protein VITISV_035499 [Vitis vinifera] Length = 595 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +2 Query: 542 IYIESMSFCLKNRAEYNPEQYLWEKNFTLAGRNYKRKDLE 661 +Y +S S K +AEYNP+QYLWEK+FTLAGR YKR+DLE Sbjct: 2 VYEDSES--TKTQAEYNPDQYLWEKDFTLAGRTYKRQDLE 39 >gb|EPS70866.1| hypothetical protein M569_03894, partial [Genlisea aurea] Length = 75 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 578 RAEYNPEQYLWEKNFTLAGRNYKRKDLE 661 RAEYNP+QYLWEK+FTLAGR YKR+DLE Sbjct: 14 RAEYNPDQYLWEKDFTLAGRKYKREDLE 41 >ref|XP_004486396.1| PREDICTED: uncharacterized protein LOC101505258 isoform X1 [Cicer arietinum] gi|502079882|ref|XP_004486397.1| PREDICTED: uncharacterized protein LOC101505258 isoform X2 [Cicer arietinum] Length = 480 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +2 Query: 578 RAEYNPEQYLWEKNFTLAGRNYKRKDLE 661 RAEYNP+QYLWEK FTLAG+N++RKDLE Sbjct: 14 RAEYNPDQYLWEKEFTLAGKNFQRKDLE 41