BLASTX nr result
ID: Catharanthus23_contig00001299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00001299 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247042.1| PREDICTED: probable xyloglucan glycosyltrans... 55 7e-06 >ref|XP_004247042.1| PREDICTED: probable xyloglucan glycosyltransferase 6-like [Solanum lycopersicum] Length = 684 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +3 Query: 168 MSRSPNYEFQEWWNKQR--HEENDIGPAPSSETSSFMTVDVGSPCSSDR 308 MSR PN EFQEWWNKQR + D+ P+ SSE SSF+TV++ SP +++ Sbjct: 1 MSRPPNQEFQEWWNKQRSANGSEDLFPS-SSENSSFLTVEISSPTVAEK 48