BLASTX nr result
ID: Catharanthus23_contig00000439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00000439 (937 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW47577.1| metallothionein-like [Gossypium hirsutum] 85 4e-14 gb|AAD22465.1|AF118230_1 metallothionein-like protein [Gossypium... 77 7e-12 gb|EMS45341.1| hypothetical protein TRIUR3_17912 [Triticum urartu] 77 9e-12 gb|EMT20371.1| hypothetical protein F775_43862 [Aegilops tauschii] 75 3e-11 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 75 5e-11 emb|CAD88266.1| metallothionein-like protein type 3 [Hordeum vul... 74 6e-11 gb|EOY13005.1| Metallothionein 3 [Theobroma cacao] 74 8e-11 gb|AGL34968.1| metallothionein type 3 [Coffea arabica] 74 8e-11 dbj|BAK06155.1| predicted protein [Hordeum vulgare subsp. vulgar... 74 1e-10 gb|ADO12864.1| metallothionein type 3-like protein [Ipomoea aqua... 73 1e-10 gb|AAK27970.1|AF242374_1 metallothionein-like protein [Ipomoea b... 72 3e-10 gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] 72 3e-10 gb|ACL80667.1| metallothionein [Solanum nigrum] 72 3e-10 sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein... 71 5e-10 gb|ACC77568.1| type 3 metallothionein [Prosopis juliflora] 71 5e-10 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 71 7e-10 dbj|BAI39990.1| metallothionein [Tamarix androssowii] 70 1e-09 gb|ACL80666.1| metallothionein [Solanum nigrum] 70 1e-09 ref|XP_003565115.1| PREDICTED: metallothionein-like protein 3B-l... 70 1e-09 gb|ACR46965.1| metallothionein 3 [Noccaea caerulescens] gi|23861... 70 1e-09 >gb|AAW47577.1| metallothionein-like [Gossypium hirsutum] Length = 63 Score = 84.7 bits (208), Expect = 4e-14 Identities = 37/63 (58%), Positives = 43/63 (68%), Gaps = 13/63 (20%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC-------------TYTESIVMEEGAENDGKCKCGTSCSCVNCTC 572 M+DKCGNCD AD +QC +Y ++V+E AENDGKCKCGTSCSC NCTC Sbjct: 1 MADKCGNCDCADKSQCVKKGNSLVIETEESYISTVVVEPLAENDGKCKCGTSCSCTNCTC 60 Query: 573 GSH 581 GSH Sbjct: 61 GSH 63 >gb|AAD22465.1|AF118230_1 metallothionein-like protein [Gossypium hirsutum] Length = 63 Score = 77.4 bits (189), Expect = 7e-12 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 14/62 (22%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCT--------------YTESIVMEEGAENDGKCKCGTSCSCVNCT 569 MSD+CGNCD AD +QCT Y + VM+ AENDGKCKCGT CSC +CT Sbjct: 1 MSDRCGNCDCADRSQCTKGNSNTMIIETEKSYINTAVMDAPAENDGKCKCGTGCSCTDCT 60 Query: 570 CG 575 CG Sbjct: 61 CG 62 >gb|EMS45341.1| hypothetical protein TRIUR3_17912 [Triticum urartu] Length = 62 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/61 (55%), Positives = 38/61 (62%), Gaps = 13/61 (21%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC-------------TYTESIVMEEGAENDGKCKCGTSCSCVNCTC 572 M+DKCGNCD AD TQC T ++E AENDGKCKCGTSC+C NCTC Sbjct: 1 MADKCGNCDCADKTQCVKKGDGFGIVMVDTEKSHFEVQEAAENDGKCKCGTSCTCTNCTC 60 Query: 573 G 575 G Sbjct: 61 G 61 >gb|EMT20371.1| hypothetical protein F775_43862 [Aegilops tauschii] Length = 62 Score = 75.5 bits (184), Expect = 3e-11 Identities = 36/61 (59%), Positives = 39/61 (63%), Gaps = 13/61 (21%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCTY---TESIVM----------EEGAENDGKCKCGTSCSCVNCTC 572 M+DKCGNCD AD TQC T IVM +E AENDGKC CGTSC+C NCTC Sbjct: 1 MADKCGNCDCADKTQCVKKGNTYGIVMVDTEKSHFEVQETAENDGKCSCGTSCTCTNCTC 60 Query: 573 G 575 G Sbjct: 61 G 61 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 74.7 bits (182), Expect = 5e-11 Identities = 36/64 (56%), Positives = 38/64 (59%), Gaps = 16/64 (25%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC-----TYTESIVMEE-----------GAENDGKCKCGTSCSCVN 563 MSD CGNCD AD TQC +YT I+ E AENDGKCKCG SCSC N Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAENDGKCKCGPSCSCTN 60 Query: 564 CTCG 575 CTCG Sbjct: 61 CTCG 64 >emb|CAD88266.1| metallothionein-like protein type 3 [Hordeum vulgare subsp. vulgare] Length = 62 Score = 74.3 bits (181), Expect = 6e-11 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 13/61 (21%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC-------------TYTESIVMEEGAENDGKCKCGTSCSCVNCTC 572 M+DKCGNCD AD TQC T + ++E AEND KCKCGTSC+C NCTC Sbjct: 1 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLEVQETAENDDKCKCGTSCTCTNCTC 60 Query: 573 G 575 G Sbjct: 61 G 61 >gb|EOY13005.1| Metallothionein 3 [Theobroma cacao] Length = 62 Score = 73.9 bits (180), Expect = 8e-11 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 13/61 (21%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC-------------TYTESIVMEEGAENDGKCKCGTSCSCVNCTC 572 MSDKCGNCD AD +QC +Y ++ +E AENDGKCKCG +C+C +CTC Sbjct: 1 MSDKCGNCDCADKSQCVKKGNTLVIETEKSYITTVAVETPAENDGKCKCGANCTCTDCTC 60 Query: 573 G 575 G Sbjct: 61 G 61 >gb|AGL34968.1| metallothionein type 3 [Coffea arabica] Length = 65 Score = 73.9 bits (180), Expect = 8e-11 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 16/63 (25%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC----------------TYTESIVMEEGAENDGKCKCGTSCSCVN 563 MSDKCGNCD AD +QC T+ E+ VM EG +GKCKCG SC+CVN Sbjct: 1 MSDKCGNCDCADRSQCVKKGSSYAADIVETENTFVETFVMMEGGAQNGKCKCGPSCACVN 60 Query: 564 CTC 572 CTC Sbjct: 61 CTC 63 >dbj|BAK06155.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|387931626|gb|AFK12211.1| metallothionein [Hordeum vulgare] Length = 62 Score = 73.6 bits (179), Expect = 1e-10 Identities = 33/61 (54%), Positives = 37/61 (60%), Gaps = 13/61 (21%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC-------------TYTESIVMEEGAENDGKCKCGTSCSCVNCTC 572 M+DKCGNCD AD TQC T + + E AEND KCKCGTSC+C NCTC Sbjct: 1 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLEVHETAENDDKCKCGTSCTCTNCTC 60 Query: 573 G 575 G Sbjct: 61 G 61 >gb|ADO12864.1| metallothionein type 3-like protein [Ipomoea aquatica] Length = 66 Score = 73.2 bits (178), Expect = 1e-10 Identities = 37/66 (56%), Positives = 42/66 (63%), Gaps = 18/66 (27%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCT-----------------YTESIVME-EGAENDGKCKCGTSCSC 557 MSDKCGNCD AD++QCT YTESIVM+ AENDG CKCG +CSC Sbjct: 1 MSDKCGNCDCADSSQCTRKGNKMDDVIFVAAEKSYTESIVMDVASAENDG-CKCGANCSC 59 Query: 558 VNCTCG 575 +CTCG Sbjct: 60 TDCTCG 65 >gb|AAK27970.1|AF242374_1 metallothionein-like protein [Ipomoea batatas] Length = 64 Score = 72.0 bits (175), Expect = 3e-10 Identities = 36/64 (56%), Positives = 40/64 (62%), Gaps = 16/64 (25%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCT----------------YTESIVMEEGAENDGKCKCGTSCSCVN 563 MSDKCGNCD AD+TQCT YTESIV + AENDG CKCG +CSC + Sbjct: 1 MSDKCGNCDCADSTQCTRKGSKMDDVIFVTEKSYTESIVKDIAAENDG-CKCGANCSCTD 59 Query: 564 CTCG 575 TCG Sbjct: 60 RTCG 63 >gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] Length = 63 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 14/62 (22%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCT---YTESIVMEE-----------GAENDGKCKCGTSCSCVNCT 569 MSDKCG+CD AD +QC YT I+ E AENDGKCKCG+SCSC +CT Sbjct: 1 MSDKCGSCDCADKSQCGKNGYTADIIETEKSYAMVMDAPAAAENDGKCKCGSSCSCTDCT 60 Query: 570 CG 575 CG Sbjct: 61 CG 62 >gb|ACL80667.1| metallothionein [Solanum nigrum] Length = 63 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 14/62 (22%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCTYTES-------------IVMEEGAE-NDGKCKCGTSCSCVNCT 569 MSDKC NCD AD +QC ES ++M+ GAE +DGKCKCG+SC+CVNCT Sbjct: 1 MSDKCSNCDCADVSQCVRKESQYDVVIVEKSETVVMMDVGAEEHDGKCKCGSSCACVNCT 60 Query: 570 CG 575 CG Sbjct: 61 CG 62 >sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein type 3 gi|1086020|pir||S48037 metallothionein-like protein - kiwi fruit gi|450241|gb|AAA53072.1| metallothionein-like protein [Actinidia deliciosa] Length = 63 Score = 71.2 bits (173), Expect = 5e-10 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 15/62 (24%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC--------------TYTESIVME-EGAENDGKCKCGTSCSCVNC 566 MSDKCGNCD AD++QC +Y E +VM AE+ GKCKCGTSC CVNC Sbjct: 1 MSDKCGNCDCADSSQCVKKGNSIDIVETDKSYIEDVVMGVPAAESGGKCKCGTSCPCVNC 60 Query: 567 TC 572 TC Sbjct: 61 TC 62 >gb|ACC77568.1| type 3 metallothionein [Prosopis juliflora] Length = 67 Score = 71.2 bits (173), Expect = 5e-10 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 18/66 (27%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC----------------TYTESIVMEEGA--ENDGKCKCGTSCSC 557 MSDKCGNCD AD +QC +Y ES +M A E+DGKCKCG SCSC Sbjct: 1 MSDKCGNCDCADKSQCVKKGNGYVADIIDPDNSYDESYMMAGAAAGEHDGKCKCGPSCSC 60 Query: 558 VNCTCG 575 V+CTCG Sbjct: 61 VDCTCG 66 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 70.9 bits (172), Expect = 7e-10 Identities = 34/64 (53%), Positives = 38/64 (59%), Gaps = 16/64 (25%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCT---------------YTESIVMEEGA-ENDGKCKCGTSCSCVN 563 MS+ CGNCD AD TQC E++VME A ENDGKCKCG +CSC N Sbjct: 1 MSNTCGNCDCADKTQCVKGNKYGVDIVETEKRMVETVVMEVPAGENDGKCKCGANCSCTN 60 Query: 564 CTCG 575 CTCG Sbjct: 61 CTCG 64 >dbj|BAI39990.1| metallothionein [Tamarix androssowii] Length = 69 Score = 70.1 bits (170), Expect = 1e-09 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 19/69 (27%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC---------------TYTES-IVMEE---GAENDGKCKCGTSCS 554 MS KCGNC AD +QC TY ES +VM++ AEN G+CKCG C+ Sbjct: 1 MSGKCGNCSCADKSQCVQKRNQYGFDLIETQTYAESTVVMDDPPTAAENGGQCKCGDRCA 60 Query: 555 CVNCTCGSH 581 CVNCTCGSH Sbjct: 61 CVNCTCGSH 69 >gb|ACL80666.1| metallothionein [Solanum nigrum] Length = 63 Score = 70.1 bits (170), Expect = 1e-09 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 14/61 (22%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCTYTES-------------IVMEEGAE-NDGKCKCGTSCSCVNCT 569 MSDKCG+CD AD +QC ES ++M+ GAE +DGKCKCG+SC+CVNCT Sbjct: 1 MSDKCGSCDCADVSQCVRKESQYDVVTVEKSETVVMMDVGAEEHDGKCKCGSSCACVNCT 60 Query: 570 C 572 C Sbjct: 61 C 61 >ref|XP_003565115.1| PREDICTED: metallothionein-like protein 3B-like [Brachypodium distachyon] Length = 63 Score = 69.7 bits (169), Expect = 1e-09 Identities = 34/62 (54%), Positives = 36/62 (58%), Gaps = 14/62 (22%) Frame = +3 Query: 432 MSDKCGNCDSADNTQCTY-----------TESI---VMEEGAENDGKCKCGTSCSCVNCT 569 MS CGNCD AD TQC TE V E AENDGKCKCGTSC+C +CT Sbjct: 1 MSSGCGNCDCADKTQCVKKGNGYGIVMVDTEKSHFEVQESAAENDGKCKCGTSCTCTSCT 60 Query: 570 CG 575 CG Sbjct: 61 CG 62 >gb|ACR46965.1| metallothionein 3 [Noccaea caerulescens] gi|238617695|gb|ACR46969.1| metallothionein 3 [Noccaea caerulescens] Length = 67 Score = 69.7 bits (169), Expect = 1e-09 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 17/64 (26%) Frame = +3 Query: 432 MSDKCGNCDSADNTQC----------------TYTESIVMEEGAENDG-KCKCGTSCSCV 560 MSDKCG+CD AD TQC +Y E++ M+ GAE +G KCKCG++CSCV Sbjct: 1 MSDKCGSCDCADKTQCVKKSTSYTLDMVETQESYKEAMNMDVGAEENGCKCKCGSTCSCV 60 Query: 561 NCTC 572 NCTC Sbjct: 61 NCTC 64