BLASTX nr result
ID: Catharanthus23_contig00000021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00000021 (611 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001144693.1| uncharacterized protein LOC100277728 [Zea ma... 56 7e-06 >ref|NP_001144693.1| uncharacterized protein LOC100277728 [Zea mays] gi|195645844|gb|ACG42390.1| hypothetical protein [Zea mays] Length = 237 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Frame = -3 Query: 465 GAARSSIIQSFTPATPPQTPGS----KRRKGIPHRAPMSGLQL 349 G+ RSS++QSFTP+TPP TP S KRRKG+PHR+P L L Sbjct: 193 GSDRSSVVQSFTPSTPPATPNSFRTGKRRKGVPHRSPFGSLVL 235