BLASTX nr result
ID: Catharanthus22_contig00048146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00048146 (249 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006394989.1| hypothetical protein EUTSA_v10003949mg [Eutr... 87 2e-15 gb|AAB61069.1| Similar to sodium/hydrogen exchanger; coded for b... 87 2e-15 ref|NP_198067.1| sodium/hydrogen exchanger 1 [Arabidopsis thalia... 87 2e-15 gb|AFF57538.1| vacuolar sodium proton antiporter [Cochlearia hol... 87 2e-15 gb|AEA51351.1| Na+/H+ antiporter-like protein [Olimarabidopsis p... 87 2e-15 ref|XP_002874403.1| hypothetical protein ARALYDRAFT_910883 [Arab... 87 2e-15 gb|ACZ92142.1| Na+/H+ antiporter [Brassica napus] 87 2e-15 gb|ABQ58865.1| Na+/H+ antiporter [Arabidopsis thaliana] 87 2e-15 ref|XP_006394990.1| hypothetical protein EUTSA_v10003949mg [Eutr... 87 2e-15 gb|ABF48496.1| sodium proton exchanger [Eutrema halophilum] 87 2e-15 gb|AAT95387.1| sodium proton exchanger [Arabidopsis thaliana] 87 2e-15 gb|AAM34759.1|AF510074_1 Na+/H+ antiporter [Arabidopsis thaliana] 87 2e-15 ref|XP_006600336.1| PREDICTED: sodium/hydrogen exchanger 2-like ... 87 3e-15 ref|XP_006584044.1| PREDICTED: sodium/hydrogen exchanger 2-like ... 87 3e-15 ref|XP_006584043.1| PREDICTED: sodium/hydrogen exchanger 2-like ... 87 3e-15 ref|XP_006584042.1| PREDICTED: sodium/hydrogen exchanger 2-like ... 87 3e-15 gb|AGE33446.1| Na+/H+ antiporter, partial [Populus euphratica] 87 3e-15 gb|AGE32866.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|... 87 3e-15 gb|ESW26217.1| hypothetical protein PHAVU_003G1006000g [Phaseolu... 87 3e-15 ref|XP_006375776.1| hypothetical protein POPTR_0013s02760g [Popu... 87 3e-15 >ref|XP_006394989.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum] gi|557091628|gb|ESQ32275.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum] Length = 544 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 273 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 316 >gb|AAB61069.1| Similar to sodium/hydrogen exchanger; coded for by A. thaliana cDNA T75860 [Arabidopsis thaliana] Length = 457 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 287 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 330 >ref|NP_198067.1| sodium/hydrogen exchanger 1 [Arabidopsis thaliana] gi|84029366|sp|Q68KI4.2|NHX1_ARATH RecName: Full=Sodium/hydrogen exchanger 1; AltName: Full=Na(+)/H(+) exchanger 1; Short=NHE-1 gi|6650177|gb|AAF21755.1|AF056190_1 Na+/H+ exchanger [Arabidopsis thaliana] gi|4324597|gb|AAD16946.1| sodium proton exchanger Nhx1 [Arabidopsis thaliana] gi|110741504|dbj|BAE98703.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|332006272|gb|AED93655.1| sodium/hydrogen exchanger 1 [Arabidopsis thaliana] gi|469400355|emb|CCH26522.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400358|emb|CCH26523.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400366|emb|CCH26524.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400372|emb|CCH26525.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400377|emb|CCH26526.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400383|emb|CCH26527.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400390|emb|CCH26528.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400394|emb|CCH26529.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400402|emb|CCH26530.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400405|emb|CCH26531.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400408|emb|CCH26532.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400410|emb|CCH26533.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400412|emb|CCH26534.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400417|emb|CCH26535.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400427|emb|CCH26536.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400430|emb|CCH26537.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400436|emb|CCH26538.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400439|emb|CCH26539.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400444|emb|CCH26540.1| Na+/H+ exchanger [Arabidopsis thaliana] gi|469400449|emb|CCH26541.1| Na+/H+ exchanger [Arabidopsis thaliana] Length = 538 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 267 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 310 >gb|AFF57538.1| vacuolar sodium proton antiporter [Cochlearia hollandica] Length = 542 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 273 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 316 >gb|AEA51351.1| Na+/H+ antiporter-like protein [Olimarabidopsis pumila] Length = 538 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 267 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 310 >ref|XP_002874403.1| hypothetical protein ARALYDRAFT_910883 [Arabidopsis lyrata subsp. lyrata] gi|297320240|gb|EFH50662.1| hypothetical protein ARALYDRAFT_910883 [Arabidopsis lyrata subsp. lyrata] Length = 542 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 271 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 314 >gb|ACZ92142.1| Na+/H+ antiporter [Brassica napus] Length = 542 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 270 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLA 313 >gb|ABQ58865.1| Na+/H+ antiporter [Arabidopsis thaliana] Length = 538 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 267 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 310 >ref|XP_006394990.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum] gi|116292770|gb|ABJ97691.1| Na+/H+ antiporter [Eutrema halophilum] gi|224995912|gb|ACN76859.1| sodium/hydrogen antiporter [Eutrema halophilum] gi|312282017|dbj|BAJ33874.1| unnamed protein product [Thellungiella halophila] gi|557091629|gb|ESQ32276.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum] Length = 545 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 273 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 316 >gb|ABF48496.1| sodium proton exchanger [Eutrema halophilum] Length = 545 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 273 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 316 >gb|AAT95387.1| sodium proton exchanger [Arabidopsis thaliana] Length = 538 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 267 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 310 >gb|AAM34759.1|AF510074_1 Na+/H+ antiporter [Arabidopsis thaliana] Length = 538 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LSGILTVFFCGIVMSHYTWHNVT SSRITTKH FATLSF+A Sbjct: 267 LFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLA 310 >ref|XP_006600336.1| PREDICTED: sodium/hydrogen exchanger 2-like [Glycine max] Length = 536 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LS ILTVFFCGIVMSHYTWHNVT SSR+TTKH+FATLSFIA Sbjct: 273 LFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATLSFIA 316 >ref|XP_006584044.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X3 [Glycine max] Length = 488 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LS ILTVFFCGIVMSHYTWHNVT SSR+TTKH+FATLSFIA Sbjct: 225 LFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATLSFIA 268 >ref|XP_006584043.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X2 [Glycine max] Length = 514 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LS ILTVFFCGIVMSHYTWHNVT SSR+TTKH+FATLSFIA Sbjct: 251 LFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATLSFIA 294 >ref|XP_006584042.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X1 [Glycine max] Length = 539 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LS ILTVFFCGIVMSHYTWHNVT SSR+TTKH+FATLSFIA Sbjct: 276 LFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATLSFIA 319 >gb|AGE33446.1| Na+/H+ antiporter, partial [Populus euphratica] Length = 145 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 L NLSGILTVFFCGIVMSHYTWHNVT SSRITTKH FAT+SFIA Sbjct: 1 LLNLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATMSFIA 44 >gb|AGE32866.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388048|gb|AGE32867.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388050|gb|AGE32868.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388052|gb|AGE32869.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388054|gb|AGE32870.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388056|gb|AGE32871.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388058|gb|AGE32872.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388060|gb|AGE32873.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388062|gb|AGE32874.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388064|gb|AGE32875.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388066|gb|AGE32876.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388068|gb|AGE32877.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388070|gb|AGE32878.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388072|gb|AGE32879.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388074|gb|AGE32880.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388076|gb|AGE32881.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388078|gb|AGE32882.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388080|gb|AGE32883.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388082|gb|AGE32884.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388084|gb|AGE32885.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388086|gb|AGE32886.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388088|gb|AGE32887.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388090|gb|AGE32888.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388092|gb|AGE32889.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388094|gb|AGE32890.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388096|gb|AGE32891.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388098|gb|AGE32892.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388100|gb|AGE32893.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388102|gb|AGE32894.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388104|gb|AGE32895.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388106|gb|AGE32896.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388108|gb|AGE32897.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388110|gb|AGE32898.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388112|gb|AGE32899.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388114|gb|AGE32900.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388116|gb|AGE32901.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388118|gb|AGE32902.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388120|gb|AGE32903.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388122|gb|AGE32904.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388124|gb|AGE32905.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388126|gb|AGE32906.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388128|gb|AGE32907.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388130|gb|AGE32908.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388132|gb|AGE32909.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388134|gb|AGE32910.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388136|gb|AGE32911.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388138|gb|AGE32912.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447388140|gb|AGE32913.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447389614|gb|AGE33404.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389616|gb|AGE33405.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389618|gb|AGE33406.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389620|gb|AGE33407.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389622|gb|AGE33408.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389624|gb|AGE33409.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389626|gb|AGE33410.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389628|gb|AGE33411.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389630|gb|AGE33412.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389632|gb|AGE33413.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389634|gb|AGE33414.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389636|gb|AGE33415.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389638|gb|AGE33416.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389640|gb|AGE33417.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389642|gb|AGE33418.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389644|gb|AGE33419.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389646|gb|AGE33420.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389648|gb|AGE33421.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389650|gb|AGE33422.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389652|gb|AGE33423.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389654|gb|AGE33424.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389656|gb|AGE33425.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389658|gb|AGE33426.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389660|gb|AGE33427.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389662|gb|AGE33428.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389664|gb|AGE33429.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389666|gb|AGE33430.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389668|gb|AGE33431.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389670|gb|AGE33432.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389672|gb|AGE33433.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389674|gb|AGE33434.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389676|gb|AGE33435.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389678|gb|AGE33436.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389680|gb|AGE33437.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389682|gb|AGE33438.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389684|gb|AGE33439.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389686|gb|AGE33440.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389688|gb|AGE33441.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389690|gb|AGE33442.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389692|gb|AGE33443.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389694|gb|AGE33444.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389696|gb|AGE33445.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389700|gb|AGE33447.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389702|gb|AGE33448.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389704|gb|AGE33449.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389706|gb|AGE33450.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447389708|gb|AGE33451.1| Na+/H+ antiporter, partial [Populus euphratica] Length = 145 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 L NLSGILTVFFCGIVMSHYTWHNVT SSRITTKH FAT+SFIA Sbjct: 1 LLNLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATMSFIA 44 >gb|ESW26217.1| hypothetical protein PHAVU_003G1006000g [Phaseolus vulgaris] Length = 546 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 LF+LS ILTVFFCGIVMSHYTWHNVT SSR+TTKH+FATLSFIA Sbjct: 271 LFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATLSFIA 314 >ref|XP_006375776.1| hypothetical protein POPTR_0013s02760g [Populus trichocarpa] gi|550324793|gb|ERP53573.1| hypothetical protein POPTR_0013s02760g [Populus trichocarpa] Length = 538 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 118 LFNLSGILTVFFCGIVMSHYTWHNVTRSSRITTKHIFATLSFIA 249 L NLSGILTVFFCGIVMSHYTWHNVT SSRITTKH FAT+SFIA Sbjct: 268 LLNLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATMSFIA 311