BLASTX nr result
ID: Catharanthus22_contig00047889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047889 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78098.1| hypothetical protein VITISV_040388 [Vitis vinifera] 57 3e-06 >emb|CAN78098.1| hypothetical protein VITISV_040388 [Vitis vinifera] Length = 1230 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 2/94 (2%) Frame = -2 Query: 344 YADGHEYYSPTAMDQLVYDNFYYLDASNNYNNLLPERIIMKNPDQLNSHFTEFNKSSK-P 168 Y DGHE S DQ DN Y +D+ + Y+N + + N N HF E ++ +K P Sbjct: 412 YHDGHESASQFVTDQWPCDNAYCVDSPSYYHNNPYGPVPLMNYHHHNKHFLETDQINKLP 471 Query: 167 PCH-SRKPSKEFVISPSHGQFEANKKRIVANDIA 69 H +PS++FV SP HGQ E + +R V + A Sbjct: 472 SLHVQNRPSRDFVFSPVHGQSEVDFERPVLKERA 505