BLASTX nr result
ID: Catharanthus22_contig00047779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047779 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82073.1| hypothetical protein VITISV_036538 [Vitis vinifera] 58 2e-06 emb|CAN82105.1| hypothetical protein VITISV_002577 [Vitis vinifera] 57 3e-06 dbj|BAA97099.1| retroelement pol polyprotein-like [Arabidopsis t... 57 3e-06 gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 57 3e-06 dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis t... 56 4e-06 gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsi... 56 4e-06 >emb|CAN82073.1| hypothetical protein VITISV_036538 [Vitis vinifera] Length = 1157 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -3 Query: 263 KDKFRLRGRKCVFLGYPYRKK*W--IDLQTNEFLTSRDVVFIEHSF 132 KDKF R RKC+F+GYP+ KK W DL++ E+ SRDV+F+E F Sbjct: 552 KDKFASRSRKCIFVGYPFGKKGWRLYDLESGEYFVSRDVIFVEPEF 597 >emb|CAN82105.1| hypothetical protein VITISV_002577 [Vitis vinifera] Length = 1109 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/46 (52%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -3 Query: 263 KDKFRLRGRKCVFLGYPYRKK*W--IDLQTNEFLTSRDVVFIEHSF 132 KDKF R RKC+F+GYP+ KK W DL++ E+ SR+V+F+E F Sbjct: 561 KDKFASRSRKCIFVGYPFGKKGWRLYDLESGEYFVSRBVIFVEAEF 606 >dbj|BAA97099.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 1098 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = -3 Query: 263 KDKFRLRGRKCVFLGYPYRKK*W--IDLQTNEFLTSRDVVFIEHSF 132 KDKF R R+CVF+GYPY KK W DL+ N+F SRDVVF E F Sbjct: 741 KDKFSERSRRCVFVGYPYGKKGWRLYDLEKNKFFVSRDVVFQETVF 786 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = -3 Query: 263 KDKFRLRGRKCVFLGYPYRKK*W--IDLQTNEFLTSRDVVFIEHSF 132 KDKF R R C+F+GYP+ KK W D++ NEFL SRDV+F E F Sbjct: 765 KDKFGQRSRSCIFVGYPFGKKGWKVYDIERNEFLVSRDVIFREEVF 810 >dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 1491 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -3 Query: 263 KDKFRLRGRKCVFLGYPYRKK*W--IDLQTNEFLTSRDVVFIEHSF 132 KDKF R R C+F+GYP+ +K W DL TNEF+ SRDVVF E+ F Sbjct: 748 KDKFGERSRLCIFVGYPFGQKGWKVYDLSTNEFIVSRDVVFRENVF 793 >gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1413 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -3 Query: 263 KDKFRLRGRKCVFLGYPYRKK*W--IDLQTNEFLTSRDVVFIEHSF 132 KDKF R R C+F+GYP+ +K W DL TNEF+ SRDVVF E+ F Sbjct: 748 KDKFGERSRLCIFVGYPFGQKGWKVYDLSTNEFIVSRDVVFRENVF 793