BLASTX nr result
ID: Catharanthus22_contig00047453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047453 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006295777.1| hypothetical protein CARUB_v10024899mg, part... 44 2e-06 >ref|XP_006295777.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella] gi|482564485|gb|EOA28675.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella] Length = 451 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 17/47 (36%), Positives = 29/47 (61%) Frame = +1 Query: 145 RLCLMNLLKDFFSIKFHLIENYNKALHEGPWFIGQHFIAIRPWEPQF 285 R+ +M+L + FF ++F L E Y AL GPW + +++ ++ W P F Sbjct: 108 RMYVMDLPRHFFMVRFELEEEYLNALTGGPWRVFGNYLMVQQWSPNF 154 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 41 IYDLW*TSLLVKVYGRTTDFKFLQSKLVELWKPT 142 ++ LW ++VKV GR L KL ELWKP+ Sbjct: 73 MHGLWKNCMIVKVLGRQIPVAVLNRKLKELWKPS 106