BLASTX nr result
ID: Catharanthus22_contig00047406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047406 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB99125.1| UBX domain-containing protein 1 [Morus notabilis] 59 9e-07 >gb|EXB99125.1| UBX domain-containing protein 1 [Morus notabilis] Length = 367 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 1 GREFLYLPRDKVDMALLKEACNLLHSAITNPFFGLLSRYGDSMD 132 G EFLYLPRDKV +A+L A + L SAITNPFFGLLSR D D Sbjct: 264 GGEFLYLPRDKVKIAVLNSAGSELKSAITNPFFGLLSRKEDDYD 307