BLASTX nr result
ID: Catharanthus22_contig00047315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047315 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD17351.1| contains similarity to retrovirus-related polypro... 55 7e-06 >gb|AAD17351.1| contains similarity to retrovirus-related polyproteins and to CCHC zinc finger protein (Pfam: PF00098, Score=16.3, E=0.051, E= 1) [Arabidopsis thaliana] gi|7267432|emb|CAB77944.1| putative polyprotein [Arabidopsis thaliana] Length = 1138 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +2 Query: 41 SKGKEANKD*SKVEGAPSRARDVKCFKCNRYEHYASNCRTKKVMIIRPNGEVISKD 208 SKGKE +R RD+KCFKC+ HYAS C K++MIIR +GEV S+D Sbjct: 265 SKGKEKEV---------TRTRDLKCFKCHGLGHYASECSNKRIMIIRDSGEVESED 311