BLASTX nr result
ID: Catharanthus22_contig00047250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047250 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525877.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_006470753.1| PREDICTED: uncharacterized protein LOC102616... 56 6e-06 >ref|XP_002525877.1| conserved hypothetical protein [Ricinus communis] gi|223534791|gb|EEF36481.1| conserved hypothetical protein [Ricinus communis] Length = 137 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +1 Query: 160 TRDMIEQAKEELQILETQQPKRFNYLKLELKSFISHLESQKLFL 291 +R++I QA+E+L+ILET P RF YLKLELKSFIS LESQ+L L Sbjct: 5 SREIIVQAEEDLRILETHHPNRFEYLKLELKSFISFLESQQLLL 48 >ref|XP_006470753.1| PREDICTED: uncharacterized protein LOC102616847 [Citrus sinensis] Length = 114 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 169 MIEQAKEELQILETQQPKRFNYLKLELKSFISHLESQK 282 M++QAKEELQ+LETQ P RF +LK+ELKSFI LESQ+ Sbjct: 1 MLKQAKEELQMLETQYPNRFGHLKMELKSFILLLESQQ 38