BLASTX nr result
ID: Catharanthus22_contig00047126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00047126 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315452.2| hypothetical protein POPTR_0010s24190g [Popu... 57 3e-06 ref|XP_006436665.1| hypothetical protein CICLE_v10033301mg [Citr... 55 7e-06 ref|XP_002311038.2| hypothetical protein POPTR_0008s02550g [Popu... 55 1e-05 ref|XP_006387234.1| hypothetical protein POPTR_1452s00200g [Popu... 55 1e-05 ref|XP_002336670.1| predicted protein [Populus trichocarpa] gi|5... 55 1e-05 >ref|XP_002315452.2| hypothetical protein POPTR_0010s24190g [Populus trichocarpa] gi|550330495|gb|EEF01623.2| hypothetical protein POPTR_0010s24190g [Populus trichocarpa] Length = 200 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/50 (48%), Positives = 39/50 (78%) Frame = -2 Query: 223 KSGKKVDGRLLMVLESFFEEIYVKRNEFFKKIFPDVYNEFVNVFKKIGEM 74 K+ +D RLLM+LE FF E++++R E KK+FP++++EF+ VFKK+G + Sbjct: 73 KAWDSIDSRLLMLLE-FFRELFIRRREVLKKLFPELHDEFLGVFKKMGNI 121 >ref|XP_006436665.1| hypothetical protein CICLE_v10033301mg [Citrus clementina] gi|568878419|ref|XP_006492191.1| PREDICTED: uncharacterized protein LOC102610852 [Citrus sinensis] gi|557538861|gb|ESR49905.1| hypothetical protein CICLE_v10033301mg [Citrus clementina] Length = 186 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/73 (42%), Positives = 42/73 (57%) Frame = -2 Query: 223 KSGKKVDGRLLMVLESFFEEIYVKRNEFFKKIFPDVYNEFVNVFKKIGEMLWRNNNSSPR 44 KS +D RLLM+L+ +F E Y + E FKK+FP ++ EF F+KIG ML + R Sbjct: 62 KSNDNIDPRLLMLLK-YFREFYAREAELFKKVFPGIHEEFAEAFRKIGAMLSQVKMQQSR 120 Query: 43 SGDGHVVMKRSLS 5 M+RSLS Sbjct: 121 V----KTMQRSLS 129 >ref|XP_002311038.2| hypothetical protein POPTR_0008s02550g [Populus trichocarpa] gi|550332257|gb|EEE88405.2| hypothetical protein POPTR_0008s02550g [Populus trichocarpa] Length = 253 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/71 (38%), Positives = 46/71 (64%) Frame = -2 Query: 286 EIGWDQMEEENGLQRPYMIRWKSGKKVDGRLLMVLESFFEEIYVKRNEFFKKIFPDVYNE 107 E G Q + + + Y + K+ + +D R LM+L FF E++ +R E FKK+FP++++E Sbjct: 122 ESGLYQQKYGDMSDKCYRNQDKAWESIDSRFLMLL-GFFRELFFRRREVFKKLFPELHDE 180 Query: 106 FVNVFKKIGEM 74 F+ +FKKIG + Sbjct: 181 FLGMFKKIGNI 191 >ref|XP_006387234.1| hypothetical protein POPTR_1452s00200g [Populus trichocarpa] gi|550305944|gb|ERP46148.1| hypothetical protein POPTR_1452s00200g [Populus trichocarpa] Length = 183 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/71 (38%), Positives = 46/71 (64%) Frame = -2 Query: 286 EIGWDQMEEENGLQRPYMIRWKSGKKVDGRLLMVLESFFEEIYVKRNEFFKKIFPDVYNE 107 E G Q + + + Y + K+ + +D R LM+L FF E++ +R E FKK+FP++++E Sbjct: 52 ESGLYQQKYGDMSDKCYRNQDKAWESIDSRFLMLL-GFFRELFFRRREVFKKLFPELHDE 110 Query: 106 FVNVFKKIGEM 74 F+ +FKKIG + Sbjct: 111 FLGMFKKIGNI 121 >ref|XP_002336670.1| predicted protein [Populus trichocarpa] gi|566253482|ref|XP_006387235.1| hypothetical protein POPTR_1452s00210g [Populus trichocarpa] gi|550305945|gb|ERP46149.1| hypothetical protein POPTR_1452s00210g [Populus trichocarpa] Length = 183 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/71 (38%), Positives = 46/71 (64%) Frame = -2 Query: 286 EIGWDQMEEENGLQRPYMIRWKSGKKVDGRLLMVLESFFEEIYVKRNEFFKKIFPDVYNE 107 E G Q + + + Y + K+ + +D R LM+L FF E++ +R E FKK+FP++++E Sbjct: 52 ESGLYQQKYGDMSDKCYRNQDKAWESIDSRFLMLL-GFFRELFFRRREVFKKLFPELHDE 110 Query: 106 FVNVFKKIGEM 74 F+ +FKKIG + Sbjct: 111 FLGMFKKIGNI 121