BLASTX nr result
ID: Catharanthus22_contig00046406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00046406 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006606936.1| PREDICTED: uncharacterized protein LOC102668... 55 1e-05 ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago ... 55 1e-05 >ref|XP_006606936.1| PREDICTED: uncharacterized protein LOC102668273 [Glycine max] Length = 280 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -3 Query: 169 LYAPWRRALVVKLLGKTVSLKVFKTHI*AL*KLDMGFEIIDTENGYFSVRF 17 LYA W+ ALV+KL+GK++ V K + + KL+ GFEI+D ++GY+ V F Sbjct: 66 LYALWQEALVIKLIGKSIGFHVMKERLTRIWKLNAGFEILDIDHGYYMVTF 116 >ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula] gi|355506051|gb|AES87193.1| hypothetical protein MTR_4g022640 [Medicago truncatula] Length = 513 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/58 (43%), Positives = 36/58 (62%) Frame = -3 Query: 175 RQLYAPWRRALVVKLLGKTVSLKVFKTHI*AL*KLDMGFEIIDTENGYFSVRFSNR*D 2 ++L PW+ ALVVKLLGK + K + + KL GFEI+D +NG++ V+F D Sbjct: 78 QELCTPWKDALVVKLLGKNLGYNTMKDRLQRIWKLQSGFEIMDNDNGFYMVKFDQEAD 135