BLASTX nr result
ID: Catharanthus22_contig00046234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00046234 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828582.1| hypothetical protein AMTR_s00129p00036660 [A... 58 1e-06 ref|XP_004288804.1| PREDICTED: probable pectinesterase/pectinest... 56 6e-06 >ref|XP_006828582.1| hypothetical protein AMTR_s00129p00036660 [Amborella trichopoda] gi|548833372|gb|ERM95998.1| hypothetical protein AMTR_s00129p00036660 [Amborella trichopoda] Length = 352 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -1 Query: 289 EGIYKENIVIGKHKLNLVLVGEGIQETIISGNRSVSTGFQT 167 EG+Y+EN+VIG HK NLV++G+GI T+I+G+RSV G+ T Sbjct: 279 EGVYEENVVIGSHKQNLVMIGDGINLTVITGSRSVGDGWTT 319 >ref|XP_004288804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like [Fragaria vesca subsp. vesca] Length = 283 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -1 Query: 286 GIYKENIVIGKHKLNLVLVGEGIQETIISGNRSVSTGFQT 167 G+Y E I++GK K NL ++GEGI +T+ISG+RS +TGF+T Sbjct: 47 GVYNEYIIVGKEKSNLTIIGEGIDKTVISGSRSNATGFRT 86