BLASTX nr result
ID: Catharanthus22_contig00046189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00046189 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67974.1| hypothetical protein VITISV_024924 [Vitis vinifera] 55 1e-05 >emb|CAN67974.1| hypothetical protein VITISV_024924 [Vitis vinifera] Length = 796 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = -2 Query: 321 PPFRSEAYGELSIEKFGKPAYRNAVHSKNEYHNFNGLLRGLFRHIRHSKKSKIPAKNVKI 142 P + EAY E ++EKF + A NA H + H+ + ++ GL RHIR+SKKSK + + Sbjct: 686 PTSKQEAYEE-AVEKFRRSAVINAPHKQQGRHHLHAMVEGLLRHIRNSKKSKAGRGGISL 744 Query: 141 LGKGQ 127 +G GQ Sbjct: 745 VGNGQ 749