BLASTX nr result
ID: Catharanthus22_contig00046058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00046058 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL75999.1|AF466646_7 putative polyprotein [Zea mays] 59 7e-07 ref|XP_002437407.1| hypothetical protein SORBIDRAFT_10g026363 [S... 55 7e-06 >gb|AAL75999.1|AF466646_7 putative polyprotein [Zea mays] Length = 2749 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 3/78 (3%) Frame = -3 Query: 225 KIQAITNWPIPQFARGLQGFLSLVGYYIKLIKDYG---TSFPRVS*RKILFNGLQSKPCF 55 K++A+++WP P ARGL+GFL L GYY K I+D+G R+ R ++ F Sbjct: 1150 KVEAVSSWPAPHSARGLRGFLGLAGYYRKFIRDFGVIAAPLTRLLRRDAFTWDDDTQAAF 1209 Query: 54 L*IKAPLSTALIQQLPNF 1 +K L+T + Q+PNF Sbjct: 1210 QQLKTALTTGPVLQMPNF 1227 >ref|XP_002437407.1| hypothetical protein SORBIDRAFT_10g026363 [Sorghum bicolor] gi|241915630|gb|EER88774.1| hypothetical protein SORBIDRAFT_10g026363 [Sorghum bicolor] Length = 1609 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 6/81 (7%) Frame = -3 Query: 225 KIQAITNWPIPQFARGLQGFLSLVGYYIKLIKDYG------TSFPRVS*RKILFNGLQSK 64 K+ A+ +WP P+ ARGL+GFL L GYY + IKDYG TS R + +++ Sbjct: 909 KVAAVQSWPQPRSARGLRGFLGLAGYYRRFIKDYGAIAAPLTSLLR---KNAFLWTAEAE 965 Query: 63 PCFL*IKAPLSTALIQQLPNF 1 F +K LS A + LP+F Sbjct: 966 DAFSALKQALSAAPVLHLPDF 986