BLASTX nr result
ID: Catharanthus22_contig00046013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00046013 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158818.1| PREDICTED: clustered mitochondria protein ho... 55 1e-05 ref|XP_004136091.1| PREDICTED: clustered mitochondria protein ho... 55 1e-05 >ref|XP_004158818.1| PREDICTED: clustered mitochondria protein homolog [Cucumis sativus] Length = 1689 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 141 ALDHRETC*DILKF*TD*IVTNLQDAAAWLEYFESKALEQQEAARNG 1 ++ H +T +ILK QDAAAWLEYFESKALEQQEAARNG Sbjct: 1054 SVQHEQTTLNILKIKLGEEDLRTQDAAAWLEYFESKALEQQEAARNG 1100 >ref|XP_004136091.1| PREDICTED: clustered mitochondria protein homolog [Cucumis sativus] Length = 1689 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 141 ALDHRETC*DILKF*TD*IVTNLQDAAAWLEYFESKALEQQEAARNG 1 ++ H +T +ILK QDAAAWLEYFESKALEQQEAARNG Sbjct: 1054 SVQHEQTTLNILKIKLGEEDLRTQDAAAWLEYFESKALEQQEAARNG 1100