BLASTX nr result
ID: Catharanthus22_contig00045878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00045878 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein A... 59 9e-07 >ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria vesca subsp. vesca] Length = 719 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/114 (31%), Positives = 55/114 (48%), Gaps = 9/114 (7%) Frame = -2 Query: 357 GGLSIPNLQKLNLAYLAKLDWCFSQHQHALWGQVFHGKYGNVQDACV----*INVPNSST 190 GGL + +N A LAK W Q+ H LW ++ KY +QD C+ I + S Sbjct: 402 GGLGLKKTADMNQAMLAKASWRIFQNDHGLWADIYRKKY--LQDCCIESSNSIAPADCSN 459 Query: 189 TWRNILKSLQILLEGIKWQLDGTPKSNF--AGSENFSVHTAY*IG---CHLPDH 43 TWR I+ ++++ +KW++ K F A + F T++ I LPDH Sbjct: 460 TWRGIVHGVELMRRNLKWRIGDGAKIKFWNATIKEFWCDTSWNISLLKSVLPDH 513