BLASTX nr result
ID: Catharanthus22_contig00045552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00045552 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK52672.1| cytokinin oxidase [Petunia x hybrida] 68 1e-09 >dbj|BAK52672.1| cytokinin oxidase [Petunia x hybrida] Length = 535 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/70 (50%), Positives = 49/70 (70%) Frame = +1 Query: 52 PAYMVFMFITNRLMSIINKFRPWLKYSSPYNKVLTVDVSNGFGFDPESTKIASTDYGKIV 231 P+Y + FI +RLMSII K RPW S PY ++L++D+++ + +ST+ STD+GKIV Sbjct: 8 PSYFIVFFIISRLMSIIGKLRPW-NPSIPY-EILSLDLASRLSANSDSTREVSTDFGKIV 65 Query: 232 QEFPAAVYKP 261 QE PAAV P Sbjct: 66 QEIPAAVLYP 75