BLASTX nr result
ID: Catharanthus22_contig00045071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00045071 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513329.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_006346024.1| PREDICTED: uncharacterized protein LOC102604... 56 4e-06 ref|XP_004243967.1| PREDICTED: uncharacterized protein LOC101253... 56 4e-06 ref|XP_002316147.1| hypothetical protein POPTR_0010s17920g [Popu... 55 1e-05 >ref|XP_002513329.1| conserved hypothetical protein [Ricinus communis] gi|223547237|gb|EEF48732.1| conserved hypothetical protein [Ricinus communis] Length = 429 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 4 NVNLQETGPIWLKFEEAMSRYGDPKKEEGSCTIL 105 NVNLQETGP+WLKFE+A+ Y D KK+ GSCTIL Sbjct: 396 NVNLQETGPLWLKFEQALGNYEDIKKDPGSCTIL 429 >ref|XP_006346024.1| PREDICTED: uncharacterized protein LOC102604381 [Solanum tuberosum] Length = 422 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +1 Query: 4 NVNLQETGPIWLKFEEAMSRYGDPKKE-EGSCTIL 105 NVNLQETGP+WL+FEEA+SRY D KKE GSC IL Sbjct: 388 NVNLQETGPMWLRFEEALSRYEDLKKEAAGSCNIL 422 >ref|XP_004243967.1| PREDICTED: uncharacterized protein LOC101253506 [Solanum lycopersicum] Length = 422 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +1 Query: 4 NVNLQETGPIWLKFEEAMSRYGDPKKE-EGSCTIL 105 NVNLQETGP+WL+FEEA+SRY D KKE GSC IL Sbjct: 388 NVNLQETGPMWLRFEEALSRYEDLKKEAAGSCNIL 422 >ref|XP_002316147.1| hypothetical protein POPTR_0010s17920g [Populus trichocarpa] gi|222865187|gb|EEF02318.1| hypothetical protein POPTR_0010s17920g [Populus trichocarpa] Length = 455 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 4 NVNLQETGPIWLKFEEAMSRYGDPKKEEGSCTIL 105 NVN QETGP+WLKFE+A+S Y D K++ G+CTIL Sbjct: 422 NVNHQETGPLWLKFEQALSNYEDIKRDPGNCTIL 455