BLASTX nr result
ID: Catharanthus22_contig00044937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00044937 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66172.1| hypothetical protein VITISV_000730 [Vitis vinifera] 65 1e-08 ref|XP_002282041.2| PREDICTED: probable actin-related protein 2/... 63 4e-08 emb|CBI23704.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_006489656.1| PREDICTED: actin-related protein 2/3 complex... 61 2e-07 ref|XP_006489655.1| PREDICTED: actin-related protein 2/3 complex... 61 2e-07 ref|XP_006489654.1| PREDICTED: actin-related protein 2/3 complex... 61 2e-07 ref|XP_006420322.1| hypothetical protein CICLE_v10005533mg [Citr... 61 2e-07 ref|XP_006294429.1| hypothetical protein CARUB_v10023443mg [Caps... 60 3e-07 ref|XP_006294428.1| hypothetical protein CARUB_v10023443mg [Caps... 60 3e-07 ref|XP_006294427.1| hypothetical protein CARUB_v10023443mg [Caps... 60 3e-07 ref|XP_002881280.1| hypothetical protein ARALYDRAFT_482281 [Arab... 60 3e-07 ref|XP_006410479.1| hypothetical protein EUTSA_v10017931mg, part... 59 7e-07 ref|XP_006354444.1| PREDICTED: actin-related protein 2/3 complex... 58 1e-06 ref|XP_006354443.1| PREDICTED: actin-related protein 2/3 complex... 58 1e-06 ref|XP_004247762.1| PREDICTED: probable actin-related protein 2/... 58 1e-06 gb|EMJ28319.1| hypothetical protein PRUPE_ppa026663mg [Prunus pe... 57 3e-06 ref|XP_002314500.2| hypothetical protein POPTR_0010s07750g [Popu... 56 4e-06 gb|EOY06156.1| Actin-related protein 2/3 complex subunit 2 [Theo... 56 4e-06 ref|NP_001189666.1| actin-related protein C2B [Arabidopsis thali... 56 4e-06 ref|XP_002528374.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >emb|CAN66172.1| hypothetical protein VITISV_000730 [Vitis vinifera] Length = 349 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVKV 285 DI++HHVEGK+LDKTVW+L+NFYA+VKYHVKV Sbjct: 238 DIFSHHVEGKQLDKTVWSLLNFYAYVKYHVKV 269 >ref|XP_002282041.2| PREDICTED: probable actin-related protein 2/3 complex subunit 2-like [Vitis vinifera] Length = 368 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI++HHVEGK+LDKTVW+L+NFYA+VKYHVK Sbjct: 238 DIFSHHVEGKQLDKTVWSLLNFYAYVKYHVK 268 >emb|CBI23704.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI++HHVEGK+LDKTVW+L+NFYA+VKYHVK Sbjct: 238 DIFSHHVEGKQLDKTVWSLLNFYAYVKYHVK 268 >ref|XP_006489656.1| PREDICTED: actin-related protein 2/3 complex subunit 2B-like isoform X3 [Citrus sinensis] Length = 368 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DIY H+EGK+LDKTVW+L+NFYA+VKYHVK Sbjct: 238 DIYPRHIEGKRLDKTVWSLLNFYAYVKYHVK 268 >ref|XP_006489655.1| PREDICTED: actin-related protein 2/3 complex subunit 2B-like isoform X2 [Citrus sinensis] Length = 368 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DIY H+EGK+LDKTVW+L+NFYA+VKYHVK Sbjct: 236 DIYPRHIEGKRLDKTVWSLLNFYAYVKYHVK 266 >ref|XP_006489654.1| PREDICTED: actin-related protein 2/3 complex subunit 2B-like isoform X1 [Citrus sinensis] Length = 370 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DIY H+EGK+LDKTVW+L+NFYA+VKYHVK Sbjct: 238 DIYPRHIEGKRLDKTVWSLLNFYAYVKYHVK 268 >ref|XP_006420322.1| hypothetical protein CICLE_v10005533mg [Citrus clementina] gi|557522195|gb|ESR33562.1| hypothetical protein CICLE_v10005533mg [Citrus clementina] Length = 296 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DIY H+EGK+LDKTVW+L+NFYA+VKYHVK Sbjct: 164 DIYPRHIEGKRLDKTVWSLLNFYAYVKYHVK 194 >ref|XP_006294429.1| hypothetical protein CARUB_v10023443mg [Capsella rubella] gi|482563137|gb|EOA27327.1| hypothetical protein CARUB_v10023443mg [Capsella rubella] Length = 377 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HVEGK+LDKTVWNL+NFYA+VKYH+K Sbjct: 241 DITSRHVEGKRLDKTVWNLLNFYAYVKYHIK 271 >ref|XP_006294428.1| hypothetical protein CARUB_v10023443mg [Capsella rubella] gi|482563136|gb|EOA27326.1| hypothetical protein CARUB_v10023443mg [Capsella rubella] Length = 365 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HVEGK+LDKTVWNL+NFYA+VKYH+K Sbjct: 229 DITSRHVEGKRLDKTVWNLLNFYAYVKYHIK 259 >ref|XP_006294427.1| hypothetical protein CARUB_v10023443mg [Capsella rubella] gi|482563135|gb|EOA27325.1| hypothetical protein CARUB_v10023443mg [Capsella rubella] Length = 364 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HVEGK+LDKTVWNL+NFYA+VKYH+K Sbjct: 228 DITSRHVEGKRLDKTVWNLLNFYAYVKYHIK 258 >ref|XP_002881280.1| hypothetical protein ARALYDRAFT_482281 [Arabidopsis lyrata subsp. lyrata] gi|297327119|gb|EFH57539.1| hypothetical protein ARALYDRAFT_482281 [Arabidopsis lyrata subsp. lyrata] Length = 370 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HVEGK+LDKTVWNL+NFYA+VKYH+K Sbjct: 235 DITSRHVEGKRLDKTVWNLLNFYAYVKYHIK 265 >ref|XP_006410479.1| hypothetical protein EUTSA_v10017931mg, partial [Eutrema salsugineum] gi|557111648|gb|ESQ51932.1| hypothetical protein EUTSA_v10017931mg, partial [Eutrema salsugineum] Length = 344 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + H+EGK LDKTVWNL+NFYA+VKYH+K Sbjct: 231 DITSRHIEGKSLDKTVWNLLNFYAYVKYHIK 261 >ref|XP_006354444.1| PREDICTED: actin-related protein 2/3 complex subunit 2B-like isoform X2 [Solanum tuberosum] Length = 374 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + H+EGK+LDKTVWNL+NFYAFVK HVK Sbjct: 238 DITSRHIEGKRLDKTVWNLLNFYAFVKNHVK 268 >ref|XP_006354443.1| PREDICTED: actin-related protein 2/3 complex subunit 2B-like isoform X1 [Solanum tuberosum] Length = 375 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + H+EGK+LDKTVWNL+NFYAFVK HVK Sbjct: 239 DITSRHIEGKRLDKTVWNLLNFYAFVKNHVK 269 >ref|XP_004247762.1| PREDICTED: probable actin-related protein 2/3 complex subunit 2-like [Solanum lycopersicum] Length = 372 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + H+EGK+LDKTVWNL+NFYAFVK HVK Sbjct: 236 DITSRHIEGKRLDKTVWNLLNFYAFVKNHVK 266 >gb|EMJ28319.1| hypothetical protein PRUPE_ppa026663mg [Prunus persica] Length = 365 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HV GK+LDKTVW+L+NFYA+VKYHVK Sbjct: 238 DISSRHVRGKRLDKTVWSLLNFYAYVKYHVK 268 >ref|XP_002314500.2| hypothetical protein POPTR_0010s07750g [Populus trichocarpa] gi|550329318|gb|EEF00671.2| hypothetical protein POPTR_0010s07750g [Populus trichocarpa] Length = 370 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HVEGKKLDKTVW+L+NFYA+VK HVK Sbjct: 238 DISSRHVEGKKLDKTVWSLLNFYAYVKNHVK 268 >gb|EOY06156.1| Actin-related protein 2/3 complex subunit 2 [Theobroma cacao] Length = 412 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + H+EGK+LDKTVW+L+NFYA+VK+HVK Sbjct: 282 DISSRHIEGKRLDKTVWSLLNFYAYVKHHVK 312 >ref|NP_001189666.1| actin-related protein C2B [Arabidopsis thaliana] gi|510437569|sp|F4IVU1.1|ARC2B_ARATH RecName: Full=Actin-related protein 2/3 complex subunit 2B; AltName: Full=Actin-related protein C2B; AltName: Full=Arp2/3 complex 34 kDa subunit; Short=p34-ARC gi|330253734|gb|AEC08828.1| actin-related protein C2B [Arabidopsis thaliana] Length = 374 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + H+EGK+LDKTVWNL+NFYA KYH+K Sbjct: 239 DITSRHIEGKRLDKTVWNLLNFYACAKYHIK 269 >ref|XP_002528374.1| conserved hypothetical protein [Ricinus communis] gi|223532242|gb|EEF34046.1| conserved hypothetical protein [Ricinus communis] Length = 355 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 190 DIYAHHVEGKKLDKTVWNLINFYAFVKYHVK 282 DI + HVEGKKLDKTVW+L+NFYA+VK HVK Sbjct: 235 DISSRHVEGKKLDKTVWSLLNFYAYVKNHVK 265