BLASTX nr result
ID: Catharanthus22_contig00044718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00044718 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28870.1| Transcription activators,DNA binding,RNA polymera... 58 1e-06 gb|EOY28869.1| Transcription activators,DNA binding,RNA polymera... 58 1e-06 ref|XP_006467340.1| PREDICTED: transcription initiation factor I... 58 1e-06 ref|XP_006449854.1| hypothetical protein CICLE_v10014841mg [Citr... 58 1e-06 gb|EPS63331.1| hypothetical protein M569_11453, partial [Genlise... 58 1e-06 ref|XP_002262798.2| PREDICTED: transcription initiation factor I... 58 1e-06 emb|CBI33123.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAN65486.1| hypothetical protein VITISV_003680 [Vitis vinifera] 58 1e-06 ref|XP_006449856.1| hypothetical protein CICLE_v10014841mg [Citr... 57 3e-06 ref|XP_006352367.1| PREDICTED: transcription initiation factor I... 57 3e-06 ref|XP_006352364.1| PREDICTED: transcription initiation factor I... 57 3e-06 ref|XP_006396740.1| hypothetical protein EUTSA_v10028564mg [Eutr... 57 3e-06 gb|EOY28871.1| Transcription activators,DNA binding,RNA polymera... 57 3e-06 ref|XP_006290188.1| hypothetical protein CARUB_v10003868mg, part... 57 3e-06 ref|XP_004250258.1| PREDICTED: transcription initiation factor I... 57 3e-06 ref|NP_001154225.2| transcription initiation factor IIF subunit ... 57 3e-06 ref|NP_192998.3| transcription initiation factor IIF subunit alp... 57 3e-06 ref|XP_002872663.1| mutant TFIIF-alpha [Arabidopsis lyrata subsp... 57 3e-06 gb|AAR28013.1| mutant TFIIF-alpha [Arabidopsis thaliana] 57 3e-06 sp|Q9SU25.1|T2FA_ARATH RecName: Full=Transcription initiation fa... 57 3e-06 >gb|EOY28870.1| Transcription activators,DNA binding,RNA polymerase II transcription factors,catalytics,transcription initiation factors isoform 2 [Theobroma cacao] Length = 473 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 5/89 (5%) Frame = -1 Query: 254 GMQGGNLYDQCREYVLRMLPFCMPHLYAWAILVMHIIFARSS-----LISSMIYIFVQFN 90 G+QG L D RE + P+ + A H+ ++S+ ++ ++ + Sbjct: 23 GLQGRQLTDPLREKY-KNKPWMLEDETGQAQYQGHLEGSQSATYYLLMMQGKEFVAIPAG 81 Query: 89 FRYNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 82 SWYNFNKVAQYKQLTLEEAEEKMKNRRKT 110 >gb|EOY28869.1| Transcription activators,DNA binding,RNA polymerase II transcription factors,catalytics,transcription initiation factors isoform 1 [Theobroma cacao] Length = 549 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 5/89 (5%) Frame = -1 Query: 254 GMQGGNLYDQCREYVLRMLPFCMPHLYAWAILVMHIIFARSS-----LISSMIYIFVQFN 90 G+QG L D RE + P+ + A H+ ++S+ ++ ++ + Sbjct: 99 GLQGRQLTDPLREKY-KNKPWMLEDETGQAQYQGHLEGSQSATYYLLMMQGKEFVAIPAG 157 Query: 89 FRYNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 158 SWYNFNKVAQYKQLTLEEAEEKMKNRRKT 186 >ref|XP_006467340.1| PREDICTED: transcription initiation factor IIF subunit alpha-like isoform X1 [Citrus sinensis] gi|568825955|ref|XP_006467341.1| PREDICTED: transcription initiation factor IIF subunit alpha-like isoform X2 [Citrus sinensis] Length = 538 Score = 57.8 bits (138), Expect = 1e-06 Identities = 37/89 (41%), Positives = 52/89 (58%), Gaps = 5/89 (5%) Frame = -1 Query: 254 GMQGGNLYDQCREYVLRMLPFCMPHLYAWAILVMHIIFARSS-----LISSMIYIFVQFN 90 G+QG + D RE + P+ + A H+ ++S+ ++ S ++ + Sbjct: 99 GLQGRQVTDTLREKY-KNKPWMLEDETGQAQYQGHLEGSQSATYYLLVMHSKEFVAIPAG 157 Query: 89 FRYNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 158 SWYNFNKVAQYKQLTLEEAEEKMKNRRKT 186 >ref|XP_006449854.1| hypothetical protein CICLE_v10014841mg [Citrus clementina] gi|567915083|ref|XP_006449855.1| hypothetical protein CICLE_v10014841mg [Citrus clementina] gi|557552465|gb|ESR63094.1| hypothetical protein CICLE_v10014841mg [Citrus clementina] gi|557552466|gb|ESR63095.1| hypothetical protein CICLE_v10014841mg [Citrus clementina] Length = 538 Score = 57.8 bits (138), Expect = 1e-06 Identities = 37/89 (41%), Positives = 52/89 (58%), Gaps = 5/89 (5%) Frame = -1 Query: 254 GMQGGNLYDQCREYVLRMLPFCMPHLYAWAILVMHIIFARSS-----LISSMIYIFVQFN 90 G+QG + D RE + P+ + A H+ ++S+ ++ S ++ + Sbjct: 99 GLQGRQVTDTLREKY-KNKPWMLEDETGQAQYQGHLEGSQSATYYLLVMHSKEFVAIPAG 157 Query: 89 FRYNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 158 SWYNFNKVAQYKQLTLEEAEEKMKNRRKT 186 >gb|EPS63331.1| hypothetical protein M569_11453, partial [Genlisea aurea] Length = 371 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRRRT Sbjct: 163 YNFNKVAQYKQLTLEEAEEKMKNRRRT 189 >ref|XP_002262798.2| PREDICTED: transcription initiation factor IIF subunit alpha-like [Vitis vinifera] Length = 534 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRRRT Sbjct: 155 YNFNKVAQYKQLTLEEAEEKMKNRRRT 181 >emb|CBI33123.3| unnamed protein product [Vitis vinifera] Length = 539 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRRRT Sbjct: 160 YNFNKVAQYKQLTLEEAEEKMKNRRRT 186 >emb|CAN65486.1| hypothetical protein VITISV_003680 [Vitis vinifera] Length = 435 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRRRT Sbjct: 56 YNFNKVAQYKQLTLEEAEEKMKNRRRT 82 >ref|XP_006449856.1| hypothetical protein CICLE_v10014841mg [Citrus clementina] gi|557552467|gb|ESR63096.1| hypothetical protein CICLE_v10014841mg [Citrus clementina] Length = 420 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = -1 Query: 164 ILVMHIIFARSSLISSMIYIFVQFNFRYNFNKVAQYKQLTLEEAEEKMKNRRRT 3 +LVMH S ++ + YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 25 LLVMH----------SKEFVAIPAGSWYNFNKVAQYKQLTLEEAEEKMKNRRKT 68 >ref|XP_006352367.1| PREDICTED: transcription initiation factor IIF subunit alpha-like isoform X4 [Solanum tuberosum] Length = 535 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 159 YNFNKVAQYKQLTLEEAEEKMKNRRKT 185 >ref|XP_006352364.1| PREDICTED: transcription initiation factor IIF subunit alpha-like isoform X1 [Solanum tuberosum] gi|565371548|ref|XP_006352365.1| PREDICTED: transcription initiation factor IIF subunit alpha-like isoform X2 [Solanum tuberosum] gi|565371550|ref|XP_006352366.1| PREDICTED: transcription initiation factor IIF subunit alpha-like isoform X3 [Solanum tuberosum] Length = 538 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 159 YNFNKVAQYKQLTLEEAEEKMKNRRKT 185 >ref|XP_006396740.1| hypothetical protein EUTSA_v10028564mg [Eutrema salsugineum] gi|557097757|gb|ESQ38193.1| hypothetical protein EUTSA_v10028564mg [Eutrema salsugineum] Length = 542 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 159 YNFNKVAQYKQLTLEEAEEKMKNRRKT 185 >gb|EOY28871.1| Transcription activators,DNA binding,RNA polymerase II transcription factors,catalytics,transcription initiation factors isoform 3 [Theobroma cacao] Length = 496 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 107 YNFNKVAQYKQLTLEEAEEKMKNRRKT 133 >ref|XP_006290188.1| hypothetical protein CARUB_v10003868mg, partial [Capsella rubella] gi|482558894|gb|EOA23086.1| hypothetical protein CARUB_v10003868mg, partial [Capsella rubella] Length = 394 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 15 YNFNKVAQYKQLTLEEAEEKMKNRRKT 41 >ref|XP_004250258.1| PREDICTED: transcription initiation factor IIF subunit alpha-like [Solanum lycopersicum] Length = 534 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 159 YNFNKVAQYKQLTLEEAEEKMKNRRKT 185 >ref|NP_001154225.2| transcription initiation factor IIF subunit alpha [Arabidopsis thaliana] gi|332657756|gb|AEE83156.1| transcription initiation factor IIF subunit alpha [Arabidopsis thaliana] Length = 506 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 15 YNFNKVAQYKQLTLEEAEEKMKNRRKT 41 >ref|NP_192998.3| transcription initiation factor IIF subunit alpha [Arabidopsis thaliana] gi|332657755|gb|AEE83155.1| transcription initiation factor IIF subunit alpha [Arabidopsis thaliana] Length = 400 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 15 YNFNKVAQYKQLTLEEAEEKMKNRRKT 41 >ref|XP_002872663.1| mutant TFIIF-alpha [Arabidopsis lyrata subsp. lyrata] gi|297318500|gb|EFH48922.1| mutant TFIIF-alpha [Arabidopsis lyrata subsp. lyrata] Length = 619 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 158 YNFNKVAQYKQLTLEEAEEKMKNRRKT 184 >gb|AAR28013.1| mutant TFIIF-alpha [Arabidopsis thaliana] Length = 640 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 158 YNFNKVAQYKQLTLEEAEEKMKNRRKT 184 >sp|Q9SU25.1|T2FA_ARATH RecName: Full=Transcription initiation factor IIF subunit alpha; Short=TFIIF-alpha; AltName: Full=General transcription factor IIF subunit 1; AltName: Full=Transcription initiation factor RAP74 homolog; Short=AtRAP74 gi|5823572|emb|CAB53754.1| putative protein [Arabidopsis thaliana] gi|7267963|emb|CAB78304.1| putative protein [Arabidopsis thaliana] Length = 649 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 83 YNFNKVAQYKQLTLEEAEEKMKNRRRT 3 YNFNKVAQYKQLTLEEAEEKMKNRR+T Sbjct: 158 YNFNKVAQYKQLTLEEAEEKMKNRRKT 184