BLASTX nr result
ID: Catharanthus22_contig00044146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00044146 (537 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Barts... 58 1e-06 ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans]... 58 1e-06 ref|YP_008814900.1| hypothetical chloroplast RF21 (chloroplast) ... 58 1e-06 ref|YP_008578583.1| hypothetical chloroplast protein (chloroplas... 58 1e-06 gb|AGW05017.1| hypothetical chloroplast protein [Vincetoxicum ro... 58 1e-06 gb|AGW04940.1| hypothetical chloroplast protein [Telosma cordata] 58 1e-06 gb|AGW04863.1| hypothetical chloroplast protein [Sisyranthus tri... 58 1e-06 gb|AGW04786.1| hypothetical chloroplast protein [Orthosia scoparia] 58 1e-06 gb|AGW04709.1| hypothetical chloroplast protein [Matelea biflora] 58 1e-06 gb|AGW04632.1| hypothetical chloroplast protein [Marsdenia astep... 58 1e-06 gb|AGW04483.1| hypothetical chloroplast protein [Astephanus trif... 58 1e-06 gb|AGW04406.1| hypothetical chloroplast protein [Araujia sericif... 58 1e-06 gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] 58 1e-06 ref|YP_008592532.1| Ycf2 (chloroplast) [Andrographis paniculata]... 58 1e-06 gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulga... 58 1e-06 ref|YP_008081309.1| hypothetical chloroplast RF2 (chloroplast) [... 58 1e-06 gb|AGJ51293.1| Ycf2 (chloroplast) [Solanum carolinense] 58 1e-06 ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 58 1e-06 ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 58 1e-06 ref|YP_635682.1| Ycf2 [Solanum tuberosum] gi|108773191|ref|YP_63... 58 1e-06 >gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] gi|576598331|gb|AHH30493.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] Length = 2269 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 118 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 151 >ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|568247135|ref|YP_008964094.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697199|gb|AHA84954.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697206|gb|AHA84961.1| hypothetical chloroplast RF2 [Ajuga reptans] Length = 2248 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_008814900.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|563940343|ref|YP_008814919.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|458599133|gb|AGG38999.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|458599154|gb|AGG39020.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] Length = 2132 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_008578583.1| hypothetical chloroplast protein (chloroplast) [Asclepias nivea] gi|545719324|ref|YP_008578600.1| hypothetical chloroplast protein (chloroplast) [Asclepias nivea] gi|544187096|gb|AGW05034.1| hypothetical chloroplast protein (chloroplast) [Asclepias nivea] gi|544187097|gb|AGW05035.1| hypothetical chloroplast protein (chloroplast) [Asclepias nivea] Length = 2063 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 124 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 157 >gb|AGW05017.1| hypothetical chloroplast protein [Vincetoxicum rossicum] Length = 2067 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 124 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 157 >gb|AGW04940.1| hypothetical chloroplast protein [Telosma cordata] Length = 2308 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >gb|AGW04863.1| hypothetical chloroplast protein [Sisyranthus trichostomus] Length = 2294 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 123 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 156 >gb|AGW04786.1| hypothetical chloroplast protein [Orthosia scoparia] Length = 2059 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 124 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 157 >gb|AGW04709.1| hypothetical chloroplast protein [Matelea biflora] Length = 1992 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 121 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 154 >gb|AGW04632.1| hypothetical chloroplast protein [Marsdenia astephanoides] Length = 204 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >gb|AGW04483.1| hypothetical chloroplast protein [Astephanus triflorus] Length = 2130 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 124 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 157 >gb|AGW04406.1| hypothetical chloroplast protein [Araujia sericifera] Length = 722 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 124 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 157 >gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] Length = 2279 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_008592532.1| Ycf2 (chloroplast) [Andrographis paniculata] gi|552541366|ref|YP_008592551.1| Ycf2 (chloroplast) [Andrographis paniculata] gi|532164880|gb|AGT79890.1| Ycf2 (chloroplast) [Andrographis paniculata] gi|532164899|gb|AGT79909.1| Ycf2 (chloroplast) [Andrographis paniculata] Length = 2256 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 118 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 151 >gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176216|gb|AFV61875.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 2261 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_008081309.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|511348399|ref|YP_008081328.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|474452120|gb|AGI51188.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|474452139|gb|AGI51207.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] Length = 2273 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >gb|AGJ51293.1| Ycf2 (chloroplast) [Solanum carolinense] Length = 2076 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|573461995|emb|CCQ71664.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] gi|573462016|emb|CCQ71685.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155 >ref|YP_635682.1| Ycf2 [Solanum tuberosum] gi|108773191|ref|YP_635701.1| Ycf2 [Solanum tuberosum] gi|109896306|sp|Q27RY7.1|YCF2_SOLTU RecName: Full=Protein Ycf2 gi|88656846|gb|ABD47099.1| hypothetical chloroplast RF2 [Solanum tuberosum] gi|88656866|gb|ABD47119.1| hypothetical chloroplast RF2 [Solanum tuberosum] gi|329124625|gb|AEB72182.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124644|gb|AEB72201.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124712|gb|AEB72268.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124731|gb|AEB72287.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] Length = 2278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -1 Query: 99 TLEKSVGSSNINRLIVSLLYLPK-RRISESCFLN 1 TLE+SVGSSNINRLIVSLLYLPK ++ISESCFLN Sbjct: 122 TLEESVGSSNINRLIVSLLYLPKGKKISESCFLN 155