BLASTX nr result
ID: Catharanthus22_contig00043839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00043839 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631226.1| PREDICTED: potassium transporter 5-like [Vit... 57 3e-06 ref|XP_003631225.1| PREDICTED: potassium transporter 5-like [Vit... 57 3e-06 emb|CBI27066.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002281572.1| PREDICTED: potassium transporter 5-like isof... 57 3e-06 ref|XP_004299195.1| PREDICTED: potassium transporter 5-like [Fra... 56 4e-06 >ref|XP_003631226.1| PREDICTED: potassium transporter 5-like [Vitis vinifera] Length = 769 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -2 Query: 229 AGTTHLKDRKFSWAKLRRVDSLNLEAGKVSFAPGHASEV 113 A LK+RK SWAKLRRVDSLNLEAG+VS A GH S+V Sbjct: 23 ADENKLKERKVSWAKLRRVDSLNLEAGRVSTAGGHTSKV 61 >ref|XP_003631225.1| PREDICTED: potassium transporter 5-like [Vitis vinifera] Length = 765 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -2 Query: 229 AGTTHLKDRKFSWAKLRRVDSLNLEAGKVSFAPGHASEV 113 A LK+RK SWAKLRRVDSLNLEAG+VS A GH S+V Sbjct: 23 ADENKLKERKVSWAKLRRVDSLNLEAGRVSTAGGHTSKV 61 >emb|CBI27066.3| unnamed protein product [Vitis vinifera] Length = 748 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -2 Query: 229 AGTTHLKDRKFSWAKLRRVDSLNLEAGKVSFAPGHASEV 113 A LK+RK SWAKLRRVDSLNLEAG+VS A GH S+V Sbjct: 23 ADENKLKERKVSWAKLRRVDSLNLEAGRVSTAGGHTSKV 61 >ref|XP_002281572.1| PREDICTED: potassium transporter 5-like isoform 1 [Vitis vinifera] Length = 793 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -2 Query: 229 AGTTHLKDRKFSWAKLRRVDSLNLEAGKVSFAPGHASEV 113 A LK+RK SWAKLRRVDSLNLEAG+VS A GH S+V Sbjct: 23 ADENKLKERKVSWAKLRRVDSLNLEAGRVSTAGGHTSKV 61 >ref|XP_004299195.1| PREDICTED: potassium transporter 5-like [Fragaria vesca subsp. vesca] Length = 792 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = -2 Query: 307 LRRKMDQNDPAAEIQSQLGDETEKAAAGTTHLKDRKFSWAKLRRVDSLNLEAGKVSFAPG 128 + K++ AE + G+E EK +K+RK SWAKLRRVDSLNLEAG+V+ + Sbjct: 1 MAEKVESMREPAETELTEGEELEKK---NEQMKERKVSWAKLRRVDSLNLEAGRVTMSHH 57 Query: 127 HASEV 113 H S+V Sbjct: 58 HGSQV 62