BLASTX nr result
ID: Catharanthus22_contig00043701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00043701 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306232.1| PREDICTED: putative disease resistance prote... 57 3e-06 >ref|XP_004306232.1| PREDICTED: putative disease resistance protein RGA3-like [Fragaria vesca subsp. vesca] Length = 1279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 6/91 (6%) Frame = +1 Query: 1 VYGLHEVHRYEEAKEANLSKKNRIERLELYWDLN------TRDEF*WSFGRSHRNVKGLK 162 +Y L V EEA++ANL +K R+ +L L W+L+ DE R H N++ L+ Sbjct: 657 IYNLEHVRDKEEAEKANLVEKKRVRKLVLTWELSRPSNSAESDEVVLEVLRPHSNLEFLE 716 Query: 163 IVNFLGINLPSWMMNTSYPFLLNNLVNLKFQ 255 I F+G+ LPSW+M L NNL ++ + Sbjct: 717 INGFMGVKLPSWLM------LSNNLKEIELE 741