BLASTX nr result
ID: Catharanthus22_contig00043664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00043664 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79134.1| hypothetical protein VITISV_000843 [Vitis vinifera] 56 4e-06 >emb|CAN79134.1| hypothetical protein VITISV_000843 [Vitis vinifera] Length = 1253 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = -2 Query: 177 IEKKILLWHCHLGHPSFPYLEHLFPKLFSNVPACTLQRDNALMLK 43 + +I++WHC LGHPSF YL+HLFP LF V + Q ++ L+ K Sbjct: 345 VRDQIMVWHCRLGHPSFSYLKHLFPVLFQKVDPLSFQCESCLLAK 389