BLASTX nr result
ID: Catharanthus22_contig00043605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00043605 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523713.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 emb|CBI17145.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002273011.1| PREDICTED: uncharacterized protein LOC100265... 57 3e-06 ref|XP_006378943.1| hypothetical protein POPTR_0009s01180g [Popu... 55 1e-05 ref|XP_002313537.2| hypothetical protein POPTR_0009s01180g [Popu... 55 1e-05 >ref|XP_002523713.1| conserved hypothetical protein [Ricinus communis] gi|223537017|gb|EEF38653.1| conserved hypothetical protein [Ricinus communis] Length = 458 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +1 Query: 112 MTAIDDAFDSDFEEPRSIALAKAKKKRKVIGLDDLLADYYEEKSKLLERES 264 M IDD D + E+P + A +K++KVIGLDDLL DYY+EKSK++ERES Sbjct: 1 MLNIDDPLDFESEDPLASTPAITQKRKKVIGLDDLLTDYYKEKSKVIERES 51 >emb|CBI17145.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +1 Query: 112 MTAIDDAFDSDFEEPRSIALAKAKKKRKVIGLDDLLADYYEEKSKLLERES 264 M +D D + E+P + KK+RKVIGLDDLL DYY+EKS+L+ERES Sbjct: 1 MIDMDGPLDFESEDPLLSSSTPKKKRRKVIGLDDLLTDYYKEKSRLVERES 51 >ref|XP_002273011.1| PREDICTED: uncharacterized protein LOC100265349 [Vitis vinifera] Length = 455 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +1 Query: 121 IDDAFDSDFEEPRSIALAKAKKKRKVIGLDDLLADYYEEKSKLLERES 264 +D D + E+P + KK+RKVIGLDDLL DYY+EKS+L+ERES Sbjct: 1 MDGPLDFESEDPLLSSSTPKKKRRKVIGLDDLLTDYYKEKSRLVERES 48 >ref|XP_006378943.1| hypothetical protein POPTR_0009s01180g [Populus trichocarpa] gi|550330791|gb|ERP56740.1| hypothetical protein POPTR_0009s01180g [Populus trichocarpa] Length = 455 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 121 IDDAFDSDFEEPRSIALAKAKKKRKVIGLDDLLADYYEEKSKLLERES 264 +D D +FE+P + KK +KVIGLDDLL D+Y+EKSK++ERES Sbjct: 1 MDAPLDFEFEDPLLNSPVIVKKSKKVIGLDDLLTDHYQEKSKVIERES 48 >ref|XP_002313537.2| hypothetical protein POPTR_0009s01180g [Populus trichocarpa] gi|550330790|gb|EEE87492.2| hypothetical protein POPTR_0009s01180g [Populus trichocarpa] Length = 443 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 121 IDDAFDSDFEEPRSIALAKAKKKRKVIGLDDLLADYYEEKSKLLERES 264 +D D +FE+P + KK +KVIGLDDLL D+Y+EKSK++ERES Sbjct: 1 MDAPLDFEFEDPLLNSPVIVKKSKKVIGLDDLLTDHYQEKSKVIERES 48