BLASTX nr result
ID: Catharanthus22_contig00042617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042617 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY20695.1| EXECUTER1 protein, chloroplast, putative isoform ... 60 4e-07 gb|EOY20693.1| EXECUTER1 protein, chloroplast, putative isoform ... 60 4e-07 ref|XP_004241496.1| PREDICTED: protein EXECUTER 1, chloroplastic... 59 5e-07 ref|XP_006439803.1| hypothetical protein CICLE_v10019209mg [Citr... 59 7e-07 ref|XP_002318039.2| hypothetical protein POPTR_0012s08110g [Popu... 58 1e-06 ref|XP_004166493.1| PREDICTED: protein EXECUTER 1, chloroplastic... 58 1e-06 ref|XP_004138282.1| PREDICTED: protein EXECUTER 1, chloroplastic... 58 1e-06 gb|EXB87876.1| hypothetical protein L484_015006 [Morus notabilis] 57 2e-06 gb|EMJ11498.1| hypothetical protein PRUPE_ppa002543mg [Prunus pe... 57 2e-06 ref|XP_002511410.1| EXECUTER1 protein, chloroplast precursor, pu... 57 2e-06 ref|XP_004298937.1| PREDICTED: protein EXECUTER 1, chloroplastic... 57 3e-06 ref|XP_003601283.1| Protein EXECUTER [Medicago truncatula] gi|35... 57 3e-06 ref|XP_006476766.1| PREDICTED: protein EXECUTER 1, chloroplastic... 55 7e-06 ref|XP_006439802.1| hypothetical protein CICLE_v10019209mg [Citr... 55 7e-06 ref|XP_004501935.1| PREDICTED: protein EXECUTER 1, chloroplastic... 55 7e-06 ref|XP_002321589.2| hypothetical protein POPTR_0015s08620g [Popu... 55 1e-05 ref|XP_003522373.1| PREDICTED: protein EXECUTER 1, chloroplastic... 55 1e-05 >gb|EOY20695.1| EXECUTER1 protein, chloroplast, putative isoform 3 [Theobroma cacao] Length = 614 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSKDSDDPFG++VRITPG+GRF Sbjct: 167 VGWWVGYSKDSDDPFGRLVRITPGVGRF 194 >gb|EOY20693.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma cacao] gi|508773438|gb|EOY20694.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma cacao] Length = 647 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSKDSDDPFG++VRITPG+GRF Sbjct: 167 VGWWVGYSKDSDDPFGRLVRITPGVGRF 194 >ref|XP_004241496.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Solanum lycopersicum] Length = 651 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSKDSDDPFG+++RITPG+GRF Sbjct: 167 VGWWVGYSKDSDDPFGRLIRITPGVGRF 194 >ref|XP_006439803.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] gi|557542065|gb|ESR53043.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] Length = 506 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 122 LLCNIPIFLFF*VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 L+ I +F+ + VGWWV YSKDSDDPFG++++I PG+GRF Sbjct: 14 LMLIIIVFMSWKVGWWVGYSKDSDDPFGRLIQIKPGVGRF 53 >ref|XP_002318039.2| hypothetical protein POPTR_0012s08110g [Populus trichocarpa] gi|550326635|gb|EEE96259.2| hypothetical protein POPTR_0012s08110g [Populus trichocarpa] Length = 648 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YS DSDDPFG++VRITPG+GRF Sbjct: 168 VGWWVGYSSDSDDPFGRLVRITPGVGRF 195 >ref|XP_004166493.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cucumis sativus] Length = 657 Score = 57.8 bits (138), Expect = 1e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YS+DSDDPFG+++RITPG+GRF Sbjct: 174 VGWWVGYSQDSDDPFGRLIRITPGVGRF 201 >ref|XP_004138282.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cucumis sativus] Length = 609 Score = 57.8 bits (138), Expect = 1e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YS+DSDDPFG+++RITPG+GRF Sbjct: 126 VGWWVGYSQDSDDPFGRLIRITPGVGRF 153 >gb|EXB87876.1| hypothetical protein L484_015006 [Morus notabilis] Length = 630 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSKDSDDPFG+++ ITPG+GRF Sbjct: 172 VGWWVGYSKDSDDPFGRLIHITPGVGRF 199 >gb|EMJ11498.1| hypothetical protein PRUPE_ppa002543mg [Prunus persica] Length = 660 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV Y KDSDDPFG+++RITPG+GRF Sbjct: 177 VGWWVGYPKDSDDPFGRLIRITPGVGRF 204 >ref|XP_002511410.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis] gi|223550525|gb|EEF52012.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis] Length = 658 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YS DSDDPFG++VRITPG+GRF Sbjct: 178 VGWWVGYSTDSDDPFGRLVRITPGVGRF 205 >ref|XP_004298937.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 654 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV Y KD+DDPFG++VRITPG+GRF Sbjct: 175 VGWWVGYPKDTDDPFGRLVRITPGVGRF 202 >ref|XP_003601283.1| Protein EXECUTER [Medicago truncatula] gi|355490331|gb|AES71534.1| Protein EXECUTER [Medicago truncatula] Length = 630 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSK+S+DPFG+I+RI+PGMGRF Sbjct: 155 VGWWVGYSKNSEDPFGRIIRISPGMGRF 182 >ref|XP_006476766.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Citrus sinensis] Length = 661 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSKDSDDPFG++++I PG+GRF Sbjct: 181 VGWWVGYSKDSDDPFGRLIQIKPGVGRF 208 >ref|XP_006439802.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] gi|567894632|ref|XP_006439804.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] gi|567894634|ref|XP_006439805.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] gi|557542064|gb|ESR53042.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] gi|557542066|gb|ESR53044.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] gi|557542067|gb|ESR53045.1| hypothetical protein CICLE_v10019209mg [Citrus clementina] Length = 659 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSKDSDDPFG++++I PG+GRF Sbjct: 179 VGWWVGYSKDSDDPFGRLIQIKPGVGRF 206 >ref|XP_004501935.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cicer arietinum] Length = 640 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSK+SDDPFG+++ I+PGMGRF Sbjct: 161 VGWWVGYSKNSDDPFGRLIHISPGMGRF 188 >ref|XP_002321589.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa] gi|550322322|gb|EEF05716.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa] Length = 655 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YS DSDDPFG++VRITP +GRF Sbjct: 175 VGWWVGYSSDSDDPFGRLVRITPDVGRF 202 >ref|XP_003522373.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max] Length = 632 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 86 VGWWVVYSKDSDDPFGKIVRITPGMGRF 3 VGWWV YSK SDDPFG+I+ I+PGMGRF Sbjct: 153 VGWWVGYSKASDDPFGRIIHISPGMGRF 180