BLASTX nr result
ID: Catharanthus22_contig00042595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042595 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339673.1| PREDICTED: ethylene-responsive transcription... 58 1e-06 ref|XP_002320179.2| hypothetical protein POPTR_0014s09020g [Popu... 57 3e-06 >ref|XP_006339673.1| PREDICTED: ethylene-responsive transcription factor CRF3-like [Solanum tuberosum] Length = 300 Score = 57.8 bits (138), Expect = 1e-06 Identities = 36/85 (42%), Positives = 42/85 (49%), Gaps = 15/85 (17%) Frame = -2 Query: 251 ASAESSLLCSPTSVLRFNNGGKLGEENKFKWRPLDDGKSQN--------------NSFWN 114 ++ E LCSPTSVLR NN + P D K N N F Sbjct: 171 STGECENLCSPTSVLRQNNNDNNNNNDDAAPAPAPDAKITNQEMNDESKKMEIDQNGFMF 230 Query: 113 DDGLPL-DQCFLNEYFDFRSPSPLI 42 DD LPL DQ FL ++FDFRSPSPL+ Sbjct: 231 DDNLPLMDQSFLKDFFDFRSPSPLM 255 >ref|XP_002320179.2| hypothetical protein POPTR_0014s09020g [Populus trichocarpa] gi|550323806|gb|EEE98494.2| hypothetical protein POPTR_0014s09020g [Populus trichocarpa] Length = 314 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/98 (36%), Positives = 54/98 (55%), Gaps = 7/98 (7%) Frame = -2 Query: 275 GYDSGKDSASAESSLLCSPTSVLRFNNGGKLGEENKFK------WRPLDDGKSQNNSFWN 114 GYDSGK+S ++ LCSPTSVLRF++ G+ G E++ WR + + Sbjct: 195 GYDSGKESHNS----LCSPTSVLRFHSTGEPGPESQAAVQSDCCWRQNQEVVQEEILKGG 250 Query: 113 DDG-LPLDQCFLNEYFDFRSPSPLIYEDQEQEHQVLED 3 DD L +D L E++DF SP+P+ +E+ VL + Sbjct: 251 DDECLVMDPLCLKEFWDFESPAPIFFEECSVPGTVLRE 288