BLASTX nr result
ID: Catharanthus22_contig00042527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042527 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518868.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_006440743.1| hypothetical protein CICLE_v10021474mg [Citr... 55 1e-05 >ref|XP_002518868.1| conserved hypothetical protein [Ricinus communis] gi|223541855|gb|EEF43401.1| conserved hypothetical protein [Ricinus communis] Length = 186 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/68 (38%), Positives = 39/68 (57%) Frame = -3 Query: 207 ISLCWVPPPQNFVKLNTDTDGYAEKNPSLGGAGGVFRNNHGDWILDFEVKLTHTTNTLTE 28 +SLCW PPP +F KLN TDG ++ G GG+ R+ +G W+ F + ++ + T E Sbjct: 33 VSLCWNPPPSSFFKLN--TDGVVHQSSGHGYVGGLIRDTNGRWVAGFSINISLCSITCAE 90 Query: 27 LVAIRTGL 4 L + GL Sbjct: 91 LWGVYQGL 98 >ref|XP_006440743.1| hypothetical protein CICLE_v10021474mg [Citrus clementina] gi|557543005|gb|ESR53983.1| hypothetical protein CICLE_v10021474mg [Citrus clementina] Length = 290 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/66 (39%), Positives = 39/66 (59%) Frame = -3 Query: 201 LCWVPPPQNFVKLNTDTDGYAEKNPSLGGAGGVFRNNHGDWILDFEVKLTHTTNTLTELV 22 +CW+PPP N+VKLN + G + + GAGG+ R+ G WIL + L + + +EL Sbjct: 121 ICWMPPPTNWVKLNIE--GSSSRAQGSAGAGGIVRDESGKWILGYSKNLGTSNSLASELW 178 Query: 21 AIRTGL 4 A+ GL Sbjct: 179 ALYHGL 184