BLASTX nr result
ID: Catharanthus22_contig00042420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042420 (448 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY16840.1| Pyridoxal phosphate (PLP)-dependent transferases ... 57 3e-06 ref|XP_006473123.1| PREDICTED: tryptophan aminotransferase-relat... 55 1e-05 >gb|EOY16840.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily protein isoform 1 [Theobroma cacao] Length = 458 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -2 Query: 441 VLRASKIIARPGIRFDVEDRFARLTSLKGQDDFDMLLYRLKQLVLTTSSEEGAK 280 VL+ +KIIAR G RF EDR+ RL+ ++ QDDFD+L+ RL +LV S E+GAK Sbjct: 406 VLKEAKIIARQGNRFGSEDRYVRLSLVRSQDDFDILIKRLNKLV---SEEDGAK 456 >ref|XP_006473123.1| PREDICTED: tryptophan aminotransferase-related protein 4-like [Citrus sinensis] Length = 455 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -2 Query: 444 DVLRASKIIARPGIRFDVEDRFARLTSLKGQDDFDMLLYRLKQLV 310 ++L+A+KII R G +F E RF RL+ LK QDDFD+LL+RL +L+ Sbjct: 408 EILKAAKIIGREGKKFRAEARFVRLSLLKSQDDFDLLLHRLDELI 452