BLASTX nr result
ID: Catharanthus22_contig00042374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042374 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004240836.1| PREDICTED: anaphase-promoting complex subuni... 86 7e-15 ref|XP_006357310.1| PREDICTED: anaphase-promoting complex subuni... 85 9e-15 gb|EXB88405.1| Anaphase-promoting complex subunit 1 [Morus notab... 75 9e-12 gb|EOY17745.1| E3 ubiquitin ligase isoform 3 [Theobroma cacao] 72 6e-11 gb|EOY17744.1| E3 ubiquitin ligase isoform 2 [Theobroma cacao] 72 6e-11 gb|EOY17743.1| E3 ubiquitin ligase isoform 1 [Theobroma cacao] 72 6e-11 ref|XP_004491057.1| PREDICTED: anaphase-promoting complex subuni... 71 1e-10 ref|XP_006595860.1| PREDICTED: anaphase-promoting complex subuni... 71 2e-10 ref|XP_002272442.2| PREDICTED: anaphase-promoting complex subuni... 71 2e-10 emb|CBI25461.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_006486303.1| PREDICTED: anaphase-promoting complex subuni... 69 5e-10 ref|XP_006486302.1| PREDICTED: anaphase-promoting complex subuni... 69 5e-10 ref|XP_004308940.1| PREDICTED: anaphase-promoting complex subuni... 69 5e-10 ref|XP_002312165.1| E3 ubiquitin ligase family protein [Populus ... 69 8e-10 ref|XP_006575544.1| PREDICTED: anaphase-promoting complex subuni... 68 1e-09 ref|XP_006575543.1| PREDICTED: anaphase-promoting complex subuni... 68 1e-09 ref|NP_196175.1| E3 ubiquitin ligase complex subunit [Arabidopsi... 68 1e-09 ref|XP_003616660.1| Anaphase-promoting complex subunit [Medicago... 67 2e-09 gb|EMJ21550.1| hypothetical protein PRUPE_ppa000101m1g, partial ... 66 5e-09 ref|XP_004148181.1| PREDICTED: anaphase-promoting complex subuni... 65 7e-09 >ref|XP_004240836.1| PREDICTED: anaphase-promoting complex subunit 1-like [Solanum lycopersicum] Length = 1771 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M +G REL++L +F+PFGL+AE LDGKPSD DYRYFLF PEVTKQ D+AD+LD S Sbjct: 1 MSIGARELTILGDFQPFGLIAEALDGKPSDACVDDYRYFLFSPEVTKQRDEADELDLPSP 60 Query: 334 S 336 S Sbjct: 61 S 61 >ref|XP_006357310.1| PREDICTED: anaphase-promoting complex subunit 1-like [Solanum tuberosum] Length = 1802 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M +G REL++L +FKPFGL+AE LDGK SD DYRYFLF PEVTKQ D+AD+LD S Sbjct: 1 MSIGARELTILGDFKPFGLIAEALDGKSSDTCGDDYRYFLFSPEVTKQRDEADELDLPSP 60 Query: 334 S 336 S Sbjct: 61 S 61 >gb|EXB88405.1| Anaphase-promoting complex subunit 1 [Morus notabilis] Length = 424 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/61 (55%), Positives = 44/61 (72%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M +GVR L+VL EFKP+GL+AE LDGKP+DD YFLF PEV +Q D+AD D + + Sbjct: 1 MSIGVRRLTVLGEFKPYGLIAEALDGKPADDFTEKCDYFLFDPEVVRQRDEADDFDASGA 60 Query: 334 S 336 + Sbjct: 61 A 61 >gb|EOY17745.1| E3 ubiquitin ligase isoform 3 [Theobroma cacao] Length = 1720 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/61 (55%), Positives = 45/61 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 MPVGVR+L+VL EFKPFGL+AE LDGKP D+ +Y Y LF PE+ +Q D+ D ++S Sbjct: 1 MPVGVRQLTVLGEFKPFGLIAEALDGKPPDNSADNYDYLLFDPEIARQRDENLDNDASAS 60 Query: 334 S 336 + Sbjct: 61 A 61 >gb|EOY17744.1| E3 ubiquitin ligase isoform 2 [Theobroma cacao] Length = 1790 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/61 (55%), Positives = 45/61 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 MPVGVR+L+VL EFKPFGL+AE LDGKP D+ +Y Y LF PE+ +Q D+ D ++S Sbjct: 1 MPVGVRQLTVLGEFKPFGLIAEALDGKPPDNSADNYDYLLFDPEIARQRDENLDNDASAS 60 Query: 334 S 336 + Sbjct: 61 A 61 >gb|EOY17743.1| E3 ubiquitin ligase isoform 1 [Theobroma cacao] Length = 1823 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/61 (55%), Positives = 45/61 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 MPVGVR+L+VL EFKPFGL+AE LDGKP D+ +Y Y LF PE+ +Q D+ D ++S Sbjct: 1 MPVGVRQLTVLGEFKPFGLIAEALDGKPPDNSADNYDYLLFDPEIARQRDENLDNDASAS 60 Query: 334 S 336 + Sbjct: 61 A 61 >ref|XP_004491057.1| PREDICTED: anaphase-promoting complex subunit 1-like [Cicer arietinum] Length = 1780 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M +GVR L++L EFKPFGL+AE LDGKP D + +Y YFLF PE+ + D DE +S Sbjct: 1 MSIGVRRLTLLGEFKPFGLIAEALDGKPPDTVAENYEYFLFDPEIARDRTAEDDCDEVAS 60 Query: 334 S 336 + Sbjct: 61 A 61 >ref|XP_006595860.1| PREDICTED: anaphase-promoting complex subunit 1-like [Glycine max] Length = 1806 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M +GVR L+VL EFKPFGL+AE LDGKP D + Y YFLF PE+ + D D D+ +S Sbjct: 1 MSIGVRCLTVLGEFKPFGLIAEALDGKPPDTVTDKYDYFLFDPEIARDRDADDDCDDVAS 60 Query: 334 S 336 + Sbjct: 61 A 61 >ref|XP_002272442.2| PREDICTED: anaphase-promoting complex subunit 1-like [Vitis vinifera] Length = 1716 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M VG+R LSVL EFKPFGL++E LDGKPSD + +Y YF+F P+V ++ D++D D S Sbjct: 1 MSVGLRRLSVLGEFKPFGLISEALDGKPSDTVLDNYDYFVFDPQVARERDESDADDAPVS 60 Query: 334 S 336 + Sbjct: 61 A 61 >emb|CBI25461.3| unnamed protein product [Vitis vinifera] Length = 1931 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M VG+R LSVL EFKPFGL++E LDGKPSD + +Y YF+F P+V ++ D++D D S Sbjct: 1 MSVGLRRLSVLGEFKPFGLISEALDGKPSDTVLDNYDYFVFDPQVARERDESDADDAPVS 60 Query: 334 S 336 + Sbjct: 61 A 61 >ref|XP_006486303.1| PREDICTED: anaphase-promoting complex subunit 1-like isoform X2 [Citrus sinensis] Length = 1517 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDAD 312 M VGVR LSVL EFKPFGL+AE LDGKP D+L Y YFLF P+ ++ +AD Sbjct: 1 MSVGVRRLSVLGEFKPFGLIAEALDGKPPDNLADKYDYFLFDPKFVRERAEAD 53 >ref|XP_006486302.1| PREDICTED: anaphase-promoting complex subunit 1-like isoform X1 [Citrus sinensis] Length = 1823 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDAD 312 M VGVR LSVL EFKPFGL+AE LDGKP D+L Y YFLF P+ ++ +AD Sbjct: 1 MSVGVRRLSVLGEFKPFGLIAEALDGKPPDNLADKYDYFLFDPKFVRERAEAD 53 >ref|XP_004308940.1| PREDICTED: anaphase-promoting complex subunit 1-like [Fragaria vesca subsp. vesca] Length = 1748 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +1 Query: 166 VRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASSS 336 VR L+VL EFKPFGL+AE LDGKP+DD+ Y YFLF P+ + D+ D D SS+ Sbjct: 6 VRHLTVLGEFKPFGLIAEALDGKPADDVPDKYDYFLFDPDTVRDRDETDDHDVLSSA 62 >ref|XP_002312165.1| E3 ubiquitin ligase family protein [Populus trichocarpa] gi|222851985|gb|EEE89532.1| E3 ubiquitin ligase family protein [Populus trichocarpa] Length = 1929 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M V V EL+VL EFKPFGL+AE LDGKP D DY YFLF PE+ + ++ D+ D S Sbjct: 1 MAVRVCELTVLGEFKPFGLIAEALDGKPPDTDPDDYDYFLFDPEIARDRNEIDETDTCGS 60 Query: 334 S 336 + Sbjct: 61 A 61 >ref|XP_006575544.1| PREDICTED: anaphase-promoting complex subunit 1-like isoform X2 [Glycine max] Length = 1806 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/61 (55%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQID-DADKLDEAS 330 M +GVR L++L EFKPFGL+AE LDGKP D + Y YFLF PE+ + D D D D AS Sbjct: 1 MSIGVRRLTLLGEFKPFGLIAEALDGKPPDTVTDKYDYFLFDPEIARDRDADDDCADIAS 60 Query: 331 S 333 + Sbjct: 61 A 61 >ref|XP_006575543.1| PREDICTED: anaphase-promoting complex subunit 1-like isoform X1 [Glycine max] Length = 1812 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/61 (55%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQID-DADKLDEAS 330 M +GVR L++L EFKPFGL+AE LDGKP D + Y YFLF PE+ + D D D D AS Sbjct: 1 MSIGVRRLTLLGEFKPFGLIAEALDGKPPDTVTDKYDYFLFDPEIARDRDADDDCADIAS 60 Query: 331 S 333 + Sbjct: 61 A 61 >ref|NP_196175.1| E3 ubiquitin ligase complex subunit [Arabidopsis thaliana] gi|75170223|sp|Q9FFF9.1|APC1_ARATH RecName: Full=Anaphase-promoting complex subunit 1; AltName: Full=Cyclosome subunit 1; AltName: Full=Protein EMBRYO DEFECTIVE 2771 gi|10178133|dbj|BAB11545.1| meiotic check point regulator-like protein [Arabidopsis thaliana] gi|332003506|gb|AED90889.1| E3 ubiquitin ligase complex subunit [Arabidopsis thaliana] Length = 1678 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLD 321 MP GVR+L+VL +FKPFGL+AE DGK DD Y+YFLF PE+T + DDAD D Sbjct: 1 MPPGVRQLTVLGKFKPFGLIAEATDGKSPDD---SYQYFLFDPELTGERDDADGND 53 >ref|XP_003616660.1| Anaphase-promoting complex subunit [Medicago truncatula] gi|355517995|gb|AES99618.1| Anaphase-promoting complex subunit [Medicago truncatula] Length = 1854 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/61 (49%), Positives = 43/61 (70%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASS 333 M +GVR L++L EFKPFGL+AE LDGK +++ +Y YFLF PE+ + D D +E +S Sbjct: 1 MSIGVRRLTLLGEFKPFGLIAESLDGKSIENVTENYEYFLFDPEIARDRDAEDDCNEVAS 60 Query: 334 S 336 + Sbjct: 61 A 61 >gb|EMJ21550.1| hypothetical protein PRUPE_ppa000101m1g, partial [Prunus persica] Length = 769 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = +1 Query: 160 VGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDADKLDEASSS 336 +GVR L+VL EFKPFGL+AE +DGKP+D++ Y YFLF E + + D+ DEAS+S Sbjct: 5 LGVRHLTVLGEFKPFGLIAEAVDGKPADNVTDKYDYFLFDHETVR---ERDETDEASAS 60 >ref|XP_004148181.1| PREDICTED: anaphase-promoting complex subunit 1-like [Cucumis sativus] Length = 1707 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +1 Query: 154 MPVGVRELSVLREFKPFGLVAEVLDGKPSDDLDSDYRYFLFGPEVTKQIDDAD 312 M GVR+L+VL FKPFGL+AE LDGKP+ + Y YFLF PE+ ++ D+ D Sbjct: 1 MSPGVRQLTVLGNFKPFGLIAEALDGKPAHTVPHHYDYFLFDPEIARERDETD 53