BLASTX nr result
ID: Catharanthus22_contig00042088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042088 (212 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163402.1| PREDICTED: endochitinase-like [Cucumis sativus] 90 4e-16 ref|XP_004134832.1| PREDICTED: endochitinase-like [Cucumis sativus] 90 4e-16 gb|EAZ02415.1| hypothetical protein OsI_24517 [Oryza sativa Indi... 89 6e-16 ref|NP_001058626.1| Os06g0726100 [Oryza sativa Japonica Group] g... 88 1e-15 gb|EEE66386.1| hypothetical protein OsJ_22712 [Oryza sativa Japo... 88 1e-15 gb|ACM45713.1| class I chitinase [Pyrus pyrifolia] 88 1e-15 emb|CAA38249.1| endochitinase [Oryza sativa] 88 1e-15 gb|EMJ03469.1| hypothetical protein PRUPE_ppa008859mg [Prunus pe... 88 1e-15 gb|AAQ84333.1| OsmChiI-34 [Oryza sativa Japonica Group] 87 3e-15 dbj|BAB40817.2| endochitinase MCHT-2 [Cucumis melo] 86 4e-15 dbj|BAO45893.1| chitinase [Acacia mangium] 86 4e-15 emb|CAA61278.1| chitinase class 1 [Vigna unguiculata] 86 4e-15 pir||S18750 chitinase (EC 3.2.1.14) precursor - western balsam p... 86 5e-15 sp|Q42993.1|CHI1_ORYSJ RecName: Full=Chitinase 1; AltName: Full=... 86 5e-15 gb|AHB62682.1| putative VF chitinase I [Dionaea muscipula] 86 5e-15 ref|XP_002312916.2| hypothetical protein POPTR_0009s14400g [Popu... 86 5e-15 ref|XP_002312923.2| Chain A family protein [Populus trichocarpa]... 86 5e-15 sp|P29031.2|CHIB_POPTR RecName: Full=Acidic endochitinase WIN6.2... 86 5e-15 prf||1901378A chitinase 86 5e-15 sp|P29032.1|CHIC_POPTR RecName: Full=Acidic endochitinase WIN6.2... 86 5e-15 >ref|XP_004163402.1| PREDICTED: endochitinase-like [Cucumis sativus] Length = 316 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 5/51 (9%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK-----TPPS 210 SGEQCGRQA ALCPNNLCCSQYGWCG T+ YC +GCQSQC+ TPPS Sbjct: 20 SGEQCGRQANGALCPNNLCCSQYGWCGDTDAYCKDGCQSQCRGSTSPTPPS 70 >ref|XP_004134832.1| PREDICTED: endochitinase-like [Cucumis sativus] Length = 316 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/51 (74%), Positives = 41/51 (80%), Gaps = 5/51 (9%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK-----TPPS 210 SGEQCGRQA ALCPNNLCCSQYGWCG T+ YC +GCQSQC+ TPPS Sbjct: 20 SGEQCGRQANGALCPNNLCCSQYGWCGDTDAYCKDGCQSQCRGSTSPTPPS 70 >gb|EAZ02415.1| hypothetical protein OsI_24517 [Oryza sativa Indica Group] Length = 320 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/52 (73%), Positives = 39/52 (75%), Gaps = 7/52 (13%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK-------TPPS 210 GEQCG QAG ALCPN LCCSQYGWCG+T DYCG GCQSQC TPPS Sbjct: 18 GEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGTGCQSQCSGGCGSGPTPPS 69 >ref|NP_001058626.1| Os06g0726100 [Oryza sativa Japonica Group] gi|82654928|sp|P24626.2|CHI3_ORYSJ RecName: Full=Chitinase 3; AltName: Full=Basic endochitinase 1; AltName: Full=Class I chitinase c; Short=OsChia1c; AltName: Full=Pathogenesis related (PR)-3 chitinase 3; Flags: Precursor gi|500617|dbj|BAA03751.1| endochitinase [Oryza sativa Japonica Group] gi|54291030|dbj|BAD61708.1| endochitinase [Oryza sativa Japonica Group] gi|54291127|dbj|BAD61800.1| endochitinase [Oryza sativa Japonica Group] gi|113596666|dbj|BAF20540.1| Os06g0726100 [Oryza sativa Japonica Group] gi|215692412|dbj|BAG87832.1| unnamed protein product [Oryza sativa Japonica Group] gi|306415967|gb|ADM86858.1| endochitinase [Oryza sativa Japonica Group] Length = 320 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/52 (73%), Positives = 39/52 (75%), Gaps = 7/52 (13%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK-------TPPS 210 GEQCG QAG ALCPN LCCSQYGWCG+T DYCG GCQSQC TPPS Sbjct: 18 GEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGAGCQSQCSGGCGGGPTPPS 69 >gb|EEE66386.1| hypothetical protein OsJ_22712 [Oryza sativa Japonica Group] Length = 235 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/52 (73%), Positives = 39/52 (75%), Gaps = 7/52 (13%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK-------TPPS 210 GEQCG QAG ALCPN LCCSQYGWCG+T DYCG GCQSQC TPPS Sbjct: 8 GEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGAGCQSQCSGGCGGGPTPPS 59 >gb|ACM45713.1| class I chitinase [Pyrus pyrifolia] Length = 317 Score = 88.2 bits (217), Expect = 1e-15 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCKTPP 207 S EQCGRQAG A+CPN LCCSQ+GWCGTT DYC GCQSQC + P Sbjct: 18 SAEQCGRQAGGAVCPNGLCCSQFGWCGTTSDYCTTGCQSQCSSTP 62 >emb|CAA38249.1| endochitinase [Oryza sativa] Length = 318 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/52 (73%), Positives = 39/52 (75%), Gaps = 7/52 (13%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK-------TPPS 210 GEQCG QAG ALCPN LCCSQYGWCG+T DYCG GCQSQC TPPS Sbjct: 18 GEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGAGCQSQCSGGCGGGPTPPS 69 >gb|EMJ03469.1| hypothetical protein PRUPE_ppa008859mg [Prunus persica] Length = 316 Score = 87.8 bits (216), Expect = 1e-15 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC 195 S EQCGRQAGNA+CPN LCCSQ+GWCGTT DYC GCQSQC Sbjct: 18 SAEQCGRQAGNAVCPNGLCCSQHGWCGTTADYCATGCQSQC 58 >gb|AAQ84333.1| OsmChiI-34 [Oryza sativa Japonica Group] Length = 298 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/52 (71%), Positives = 39/52 (75%), Gaps = 8/52 (15%) Frame = +1 Query: 79 EQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK--------TPPS 210 EQCG QAG ALCPN LCCSQYGWCG+T DYCG+GCQSQC TPPS Sbjct: 1 EQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGSGCQSQCSGSCGGGGPTPPS 52 >dbj|BAB40817.2| endochitinase MCHT-2 [Cucumis melo] Length = 311 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 3/48 (6%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK---TPP 207 S EQCGRQA ALCPNNLCCSQ+G+CG T+DYC NGCQSQC+ TPP Sbjct: 19 SAEQCGRQANGALCPNNLCCSQFGFCGDTDDYCKNGCQSQCRGSSTPP 66 >dbj|BAO45893.1| chitinase [Acacia mangium] Length = 323 Score = 86.3 bits (212), Expect = 4e-15 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 79 EQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCKTPPS 210 EQCGRQAG ALCP LCCSQ+GWCG+T+DYCG GCQSQC P+ Sbjct: 24 EQCGRQAGGALCPGGLCCSQFGWCGSTDDYCGRGCQSQCGGAPA 67 >emb|CAA61278.1| chitinase class 1 [Vigna unguiculata] Length = 321 Score = 86.3 bits (212), Expect = 4e-15 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCKTPPS 210 GEQCG QAG ALCP LCCSQ+GWCG+T+DYCG GCQSQC P+ Sbjct: 24 GEQCGSQAGGALCPGGLCCSQFGWCGSTDDYCGKGCQSQCGGQPA 68 >pir||S18750 chitinase (EC 3.2.1.14) precursor - western balsam poplar x cottonwood Length = 336 Score = 85.9 bits (211), Expect = 5e-15 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC 195 S EQCG+QAG+ALCP LCCS YGWCGTT DYCG+GCQSQC Sbjct: 20 SAEQCGQQAGDALCPGGLCCSSYGWCGTTADYCGDGCQSQC 60 >sp|Q42993.1|CHI1_ORYSJ RecName: Full=Chitinase 1; AltName: Full=Class I chitinase a; Short=OsChia1a; AltName: Full=Pathogenesis related (PR)-3 chitinase 1; Flags: Precursor gi|500615|dbj|BAA03749.1| endochitinase [Oryza sativa Japonica Group] gi|54291031|dbj|BAD61709.1| endochitinase [Oryza sativa Japonica Group] gi|54291128|dbj|BAD61801.1| endochitinase [Oryza sativa Japonica Group] gi|119395206|gb|ABL74564.1| chitinase [Oryza sativa Japonica Group] gi|125598558|gb|EAZ38338.1| hypothetical protein OsJ_22713 [Oryza sativa Japonica Group] Length = 323 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/53 (69%), Positives = 39/53 (73%), Gaps = 8/53 (15%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK--------TPPS 210 GEQCG QAG ALCPN LCCSQYGWCG+T YCG+GCQSQC TPPS Sbjct: 20 GEQCGSQAGGALCPNCLCCSQYGWCGSTSAYCGSGCQSQCSGSCGGGGPTPPS 72 >gb|AHB62682.1| putative VF chitinase I [Dionaea muscipula] Length = 314 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/46 (78%), Positives = 37/46 (80%), Gaps = 2/46 (4%) Frame = +1 Query: 79 EQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC--KTPPS 210 EQCG QAG ALCPN LCCSQYGWCGTT YCG GCQSQC +PPS Sbjct: 21 EQCGSQAGGALCPNGLCCSQYGWCGTTSAYCGAGCQSQCGGSSPPS 66 >ref|XP_002312916.2| hypothetical protein POPTR_0009s14400g [Populus trichocarpa] gi|550331711|gb|EEE86871.2| hypothetical protein POPTR_0009s14400g [Populus trichocarpa] Length = 336 Score = 85.9 bits (211), Expect = 5e-15 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC 195 S EQCG+QAG+ALCP LCCS YGWCGTT DYCG+GCQSQC Sbjct: 20 SAEQCGQQAGDALCPGGLCCSSYGWCGTTADYCGDGCQSQC 60 >ref|XP_002312923.2| Chain A family protein [Populus trichocarpa] gi|550331710|gb|EEE86878.2| Chain A family protein [Populus trichocarpa] Length = 318 Score = 85.9 bits (211), Expect = 5e-15 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC 195 S EQCG QAG ALCP LCCSQ+GWCG+T DYCGNGCQSQC Sbjct: 20 SAEQCGSQAGGALCPGGLCCSQFGWCGSTNDYCGNGCQSQC 60 >sp|P29031.2|CHIB_POPTR RecName: Full=Acidic endochitinase WIN6.2B; Flags: Precursor gi|1197373|emb|CAA42612.1| gwin6.2b [Populus trichocarpa] Length = 303 Score = 85.9 bits (211), Expect = 5e-15 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC 195 S EQCG+QAG+ALCP LCCS YGWCGTT DYCG+GCQSQC Sbjct: 20 SAEQCGQQAGDALCPGGLCCSSYGWCGTTADYCGDGCQSQC 60 >prf||1901378A chitinase Length = 307 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/53 (69%), Positives = 39/53 (73%), Gaps = 8/53 (15%) Frame = +1 Query: 76 GEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQCK--------TPPS 210 GEQCG QAG ALCPN LCCSQYGWCG+T YCG+GCQSQC TPPS Sbjct: 4 GEQCGSQAGGALCPNCLCCSQYGWCGSTSAYCGSGCQSQCSGSCGGGGPTPPS 56 >sp|P29032.1|CHIC_POPTR RecName: Full=Acidic endochitinase WIN6.2C; Flags: Precursor gi|81594|pir||S18751 chitinase (EC 3.2.1.14) precursor - western balsam poplar x cottonwood (fragment) gi|20949|emb|CAA42614.1| gwin6.2c [Populus trichocarpa] Length = 121 Score = 85.9 bits (211), Expect = 5e-15 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 73 SGEQCGRQAGNALCPNNLCCSQYGWCGTTEDYCGNGCQSQC 195 S EQCGRQAG+ALCP LCCS YGWCGTT DYCG+GCQSQC Sbjct: 21 SAEQCGRQAGDALCPGGLCCSFYGWCGTTVDYCGDGCQSQC 61