BLASTX nr result
ID: Catharanthus22_contig00042070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042070 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305827.1| PREDICTED: putative ribonuclease H protein A... 82 1e-13 gb|EPS64876.1| hypothetical protein M569_09903, partial [Genlise... 78 1e-12 ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein A... 78 1e-12 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [... 78 1e-12 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus pe... 78 1e-12 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus pe... 78 1e-12 gb|EMJ14411.1| hypothetical protein PRUPE_ppb013620mg [Prunus pe... 77 2e-12 gb|EMJ22359.1| hypothetical protein PRUPE_ppa020332mg, partial [... 77 2e-12 dbj|BAF01759.1| putative non-LTR retroelement reverse transcript... 77 3e-12 gb|AAD21778.1| putative non-LTR retroelement reverse transcripta... 77 3e-12 gb|AAD17398.1| putative non-LTR retroelement reverse transcripta... 77 3e-12 gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza ... 76 4e-12 gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japo... 76 4e-12 gb|AAP53315.2| retrotransposon protein, putative, unclassified [... 76 4e-12 gb|EMJ08998.1| hypothetical protein PRUPE_ppa024472mg, partial [... 75 7e-12 gb|EEC81735.1| hypothetical protein OsI_25376 [Oryza sativa Indi... 75 7e-12 gb|EEC84982.1| hypothetical protein OsI_32248 [Oryza sativa Indi... 75 9e-12 gb|ABA98491.1| retrotransposon protein, putative, unclassified [... 75 1e-11 gb|EMJ25392.1| hypothetical protein PRUPE_ppa017155mg, partial [... 74 2e-11 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [... 74 2e-11 >ref|XP_004305827.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria vesca subsp. vesca] Length = 888 Score = 81.6 bits (200), Expect = 1e-13 Identities = 46/111 (41%), Positives = 65/111 (58%) Frame = +1 Query: 124 NSYIAAVRI*S*SLVPTL*LHNQHAGRSTTTSLFCLTNIVYFMSKAFNRVEWNYLEAVMI 303 ++Y+ I +L+ T H HA R F L + SKA++R+EW++LEA ++ Sbjct: 106 SAYVPGKLISDNTLIATEVAHFMHALRKQQEGFFSLKLDI---SKAYDRLEWHFLEAKLL 162 Query: 304 AMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQGDPLSPYLFI 456 + VT +M V S++Y +L+NG T SP RGIRQGDPLSPYLFI Sbjct: 163 NLGFAQAWVTQIMLGVTSVQYSILLNGKPTEVISPSRGIRQGDPLSPYLFI 213 >gb|EPS64876.1| hypothetical protein M569_09903, partial [Genlisea aurea] Length = 842 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/88 (43%), Positives = 58/88 (65%) Frame = +1 Query: 193 HAGRSTTTSLFCLTNIVYFMSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKV 372 H+ R +S+F ++ +SKA++R+EW+++ V+ +M P + +M + S+ Y V Sbjct: 406 HSLRRNQSSIF--GSLKLDVSKAYDRLEWSFIREVLESMAFPARFIDLVMLLISSVTYSV 463 Query: 373 LINGSLTPFFSPFRGIRQGDPLSPYLFI 456 L+NGS F+P RGIRQGDPLSPYLFI Sbjct: 464 LVNGSTAGRFAPTRGIRQGDPLSPYLFI 491 >ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria italica] Length = 950 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/69 (50%), Positives = 49/69 (71%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEWNYLE +M+ M V+ ++ + ++ Y+V +NG LT P RG+RQG Sbjct: 152 MSKAYDRVEWNYLEKIMLKMGFSRRWVSLILCCISTVTYRVKVNGVLTEEIKPTRGLRQG 211 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 212 DPLSPYLFL 220 >gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica] Length = 925 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW +LE +M+AM P+ V +M V ++ Y L+NG T P RG+RQG Sbjct: 176 MSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQG 235 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 236 DPLSPYLFL 244 >gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica] Length = 1275 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW +LE +M+AM P+ V +M V ++ Y L+NG T P RG+RQG Sbjct: 541 MSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQG 600 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 601 DPLSPYLFL 609 >gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica] Length = 1755 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/69 (52%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW +LE +M+AM P+ V +M V ++ Y L+NG T P RG+RQG Sbjct: 995 MSKAYDRVEWEFLEKMMLAMGFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQG 1054 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 1055 DPLSPYLFL 1063 >gb|EMJ14411.1| hypothetical protein PRUPE_ppb013620mg [Prunus persica] Length = 993 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/69 (46%), Positives = 53/69 (76%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 +SKA++R+ W ++E+V++ + +P + + +M+ V +++Y++ ING LT FSP GIRQG Sbjct: 791 LSKAYDRLNWGFIESVLLEVGLPNSFIQLIMQCVSTMRYQICINGELTDPFSPGNGIRQG 850 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 851 DPLSPYLFV 859 >gb|EMJ22359.1| hypothetical protein PRUPE_ppa020332mg, partial [Prunus persica] Length = 337 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/69 (46%), Positives = 49/69 (71%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 +SK ++R+ WN++E V+ + +P +L+ +M YV S+ Y+V +N LT F+P G RQG Sbjct: 28 LSKVYDRLSWNFIEVVLHEVGLPTSLIQLIMEYVSSVTYQVCVNEDLTSTFTPSNGTRQG 87 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 88 DPLSPYLFV 96 >dbj|BAF01759.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 400 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/69 (50%), Positives = 49/69 (71%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L A+M+ M V ++ + S+ YK+L+NGS F P RGIRQG Sbjct: 158 MSKAYDRVEWSFLRALMLKMGFAQKWVDWIIFCISSVSYKILLNGSPKGFIKPSRGIRQG 217 Query: 430 DPLSPYLFI 456 DP+SP+LFI Sbjct: 218 DPISPFLFI 226 >gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1715 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/69 (56%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 +SKA++RVEWN+LE VMI + V +M V S+ Y+VLINGS P RGIRQG Sbjct: 939 ISKAYDRVEWNFLEKVMIQLGFAPRWVKWIMTCVTSVSYEVLINGSPYGKIFPSRGIRQG 998 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 999 DPLSPYLFL 1007 >gb|AAD17398.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1225 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/69 (50%), Positives = 49/69 (71%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L A+M+ M V ++ + S+ YK+L+NGS F P RGIRQG Sbjct: 524 MSKAYDRVEWSFLRALMLKMGFAQKWVDWIIFCISSVSYKILLNGSPKGFIKPSRGIRQG 583 Query: 430 DPLSPYLFI 456 DP+SP+LFI Sbjct: 584 DPISPFLFI 592 >gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza sativa Japonica Group] Length = 1509 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/69 (47%), Positives = 51/69 (73%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L +M+ + + V +M+ V ++ Y++ +NG L+ FSP RG+RQG Sbjct: 778 MSKAYDRVEWSFLHDMMLKLGFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQG 837 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 838 DPLSPYLFL 846 >gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group] Length = 1594 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/69 (47%), Positives = 51/69 (73%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L +M+ + + V +M+ V ++ Y++ +NG L+ FSP RG+RQG Sbjct: 806 MSKAYDRVEWSFLHDMMLKLGFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQG 865 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 866 DPLSPYLFL 874 >gb|AAP53315.2| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 1505 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/69 (47%), Positives = 51/69 (73%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L +M+ + + V +M+ V ++ Y++ +NG L+ FSP RG+RQG Sbjct: 774 MSKAYDRVEWSFLHDMMLKLGFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQG 833 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 834 DPLSPYLFL 842 >gb|EMJ08998.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica] Length = 920 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/69 (52%), Positives = 49/69 (71%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 M+KA++RVEW++LEA++ + + V +M V S+ Y VLING P F P RG+RQG Sbjct: 158 MNKAYDRVEWDFLEALLCKLGFCDHWVRLIMACVSSVSYSVLINGKPGPTFRPSRGLRQG 217 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 218 DPLSPYLFL 226 >gb|EEC81735.1| hypothetical protein OsI_25376 [Oryza sativa Indica Group] Length = 235 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L +M+ + +M+ V S+ Y++ +NG LT F P RG+RQG Sbjct: 22 MSKAYDRVEWHFLREMMLRLGFDEGWTNLIMQCVTSVSYRIKVNGELTDVFHPGRGLRQG 81 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 82 DPLSPYLFL 90 >gb|EEC84982.1| hypothetical protein OsI_32248 [Oryza sativa Indica Group] gi|222630794|gb|EEE62926.1| hypothetical protein OsJ_17731 [Oryza sativa Japonica Group] Length = 893 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/69 (47%), Positives = 49/69 (71%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++LE +M+ + V +MR V ++ Y++ +NG LT P RG+RQG Sbjct: 252 MSKAYDRVEWSFLEKMMVRLGFAEGWVKLIMRCVSTVTYRIKVNGDLTDQIIPSRGLRQG 311 Query: 430 DPLSPYLFI 456 DP+SPYLF+ Sbjct: 312 DPISPYLFL 320 >gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 1621 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/69 (46%), Positives = 51/69 (73%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L +++ + + V +M+ V ++ Y++ +NG L+ FSP RG+RQG Sbjct: 833 MSKAYDRVEWSFLHDMILKLGFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPGRGLRQG 892 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 893 DPLSPYLFL 901 >gb|EMJ25392.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica] Length = 916 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++LEA+M M + +M YV ++ Y ++NG+ + P RG+RQG Sbjct: 460 MSKAYDRVEWSFLEALMKGMGFAPRWIQLIMEYVTTVSYSFMLNGNPVGYVIPQRGLRQG 519 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 520 DPLSPYLFL 528 >gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica] Length = 887 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = +1 Query: 250 MSKAFNRVEWNYLEAVMIAMHVPLNLVTHLMRYVRSIKYKVLINGSLTPFFSPFRGIRQG 429 MSKA++RVEW++L+A+M + + ++ + S+ Y LING LT + P RG+RQG Sbjct: 158 MSKAYDRVEWHFLQAIMGKLGFNARWINLVLTCISSVSYSFLINGILTGYLHPSRGLRQG 217 Query: 430 DPLSPYLFI 456 DPLSPYLF+ Sbjct: 218 DPLSPYLFL 226