BLASTX nr result
ID: Catharanthus22_contig00042011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00042011 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353793.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_004243907.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 gb|EMJ23067.1| hypothetical protein PRUPE_ppa018370mg, partial [... 78 1e-12 ref|XP_006453154.1| hypothetical protein CICLE_v10007840mg [Citr... 65 1e-08 ref|XP_006412634.1| hypothetical protein EUTSA_v10024712mg [Eutr... 64 2e-08 gb|ESW20346.1| hypothetical protein PHAVU_006G201000g [Phaseolus... 63 5e-08 ref|XP_006283376.1| hypothetical protein CARUB_v10004419mg [Caps... 61 1e-07 ref|XP_003547103.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_002867315.1| pentatricopeptide repeat-containing protein ... 58 1e-06 sp|O65543.2|PP343_ARATH RecName: Full=Pentatricopeptide repeat-c... 57 3e-06 ref|NP_194836.1| pentatricopeptide repeat-containing protein [Ar... 57 3e-06 >ref|XP_006353793.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31070, mitochondrial-like [Solanum tuberosum] Length = 599 Score = 85.1 bits (209), Expect = 9e-15 Identities = 51/110 (46%), Positives = 67/110 (60%) Frame = -1 Query: 337 RLIKRFISTSVTGTLLSNLDYYIANVKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFIL 158 ++I+RFIST LS+ +K L++KG +A++LY VH S S+ F+L Sbjct: 3 KIIQRFIST------LSSFSEVHNTIKQLVVKGKYDQALELYTAKVHC---SDASSTFLL 53 Query: 157 PSIIKACAHSQTHKSLAHLLHSSTLKNGFDSECTVSNSLISHYSKFSDTK 8 PSIIKAC H Q LHS LKNG+ SEC +SNSLIS Y+KF +TK Sbjct: 54 PSIIKACVHDQL---FGLQLHSYVLKNGYSSECAISNSLISMYAKFFETK 100 >ref|XP_004243907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31070, mitochondrial-like [Solanum lycopersicum] Length = 603 Score = 84.0 bits (206), Expect = 2e-14 Identities = 52/108 (48%), Positives = 64/108 (59%) Frame = -1 Query: 331 IKRFISTSVTGTLLSNLDYYIANVKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPS 152 IKRFIST L S +K L++KG +A++LY VH SH S+ F+LPS Sbjct: 5 IKRFIST-----LSSPFSEVHNTIKQLVVKGKYDQALELYTAKVHC---SHTSSTFLLPS 56 Query: 151 IIKACAHSQTHKSLAHLLHSSTLKNGFDSECTVSNSLISHYSKFSDTK 8 IIKAC H Q LHS LKNG+ SE +SNSLIS Y+KF +TK Sbjct: 57 IIKACVHDQL---FGFQLHSYVLKNGYSSESAISNSLISMYAKFFETK 101 >gb|EMJ23067.1| hypothetical protein PRUPE_ppa018370mg, partial [Prunus persica] Length = 412 Score = 77.8 bits (190), Expect = 1e-12 Identities = 46/106 (43%), Positives = 71/106 (66%) Frame = -1 Query: 334 LIKRFISTSVTGTLLSNLDYYIANVKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILP 155 +I+RF S+ +S L++ +KDL++KGL + ++LY + +HP F H ++ FILP Sbjct: 5 VIRRFTSSLSPALTISALNF---KIKDLVVKGLYDQILRLYKQELHP-FGLHANS-FILP 59 Query: 154 SIIKACAHSQTHKSLAHLLHSSTLKNGFDSECTVSNSLISHYSKFS 17 SIIKAC+++ +H LH +LK+G DS+ VSNSLIS Y+KF+ Sbjct: 60 SIIKACSYAMSHH-FGLQLHCLSLKSGCDSDPVVSNSLISMYAKFT 104 >ref|XP_006453154.1| hypothetical protein CICLE_v10007840mg [Citrus clementina] gi|557556380|gb|ESR66394.1| hypothetical protein CICLE_v10007840mg [Citrus clementina] Length = 580 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/71 (46%), Positives = 48/71 (67%) Frame = -1 Query: 229 KAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTHKSLAHLLHSSTLKNGFDSECTVS 50 + + LY + +HP +A ILPS+IKACA++QTH+ LH + LK+G D++ +S Sbjct: 9 QTLHLYKQELHPSGLYSNTA--ILPSVIKACAYAQTHQHFGLQLHCTALKSGSDADPVIS 66 Query: 49 NSLISHYSKFS 17 NSLIS Y+KFS Sbjct: 67 NSLISMYAKFS 77 >ref|XP_006412634.1| hypothetical protein EUTSA_v10024712mg [Eutrema salsugineum] gi|557113804|gb|ESQ54087.1| hypothetical protein EUTSA_v10024712mg [Eutrema salsugineum] Length = 602 Score = 63.9 bits (154), Expect = 2e-08 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 1/94 (1%) Frame = -1 Query: 289 SNLDYYIAN-VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTHKS 113 S L+ + N +K L+ + L+ +A++LY + +HP+ + +A ILPS+IKAC+ Sbjct: 10 SRLNLELGNKLKGLVSEQLHDEALRLYKQKIHPLGTNGFTA--ILPSVIKACSFQHEPFL 67 Query: 112 LAHLLHSSTLKNGFDSECTVSNSLISHYSKFSDT 11 L +H LK+G D + VSNSLIS Y+KFS T Sbjct: 68 LGEQIHCLCLKSGADRDTVVSNSLISMYAKFSTT 101 >gb|ESW20346.1| hypothetical protein PHAVU_006G201000g [Phaseolus vulgaris] Length = 607 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/86 (40%), Positives = 56/86 (65%) Frame = -1 Query: 262 VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTHKSLAHLLHSSTL 83 +K L KGL + ++L+ + +H F +H S F+LPS+I+A + +Q+H + A LH L Sbjct: 23 IKTFLSKGLYYQILQLFTQ-LH--FSAHSSIPFLLPSVIRASSSAQSH-AFATQLHCFAL 78 Query: 82 KNGFDSECTVSNSLISHYSKFSDTKN 5 K + SE VSNS+I+ Y+KFSD ++ Sbjct: 79 KTAYHSEAVVSNSIITMYAKFSDVES 104 >ref|XP_006283376.1| hypothetical protein CARUB_v10004419mg [Capsella rubella] gi|482552081|gb|EOA16274.1| hypothetical protein CARUB_v10004419mg [Capsella rubella] Length = 598 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/84 (41%), Positives = 52/84 (61%) Frame = -1 Query: 262 VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTHKSLAHLLHSSTL 83 +K L+ + L+ +A++LY +HP+ + +A ILPS+IKAC+ Q L LH Sbjct: 17 LKGLVSEQLHDEALRLYKLDIHPLGTNGFTA--ILPSVIKACSFQQEPFLLGTQLHCLCF 74 Query: 82 KNGFDSECTVSNSLISHYSKFSDT 11 K+G D + +SNSLIS Y+KFS T Sbjct: 75 KSGADRDTVISNSLISLYAKFSST 98 >ref|XP_003547103.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31070, mitochondrial-like [Glycine max] Length = 601 Score = 58.2 bits (139), Expect = 1e-06 Identities = 36/83 (43%), Positives = 49/83 (59%) Frame = -1 Query: 262 VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTHKSLAHLLHSSTL 83 +K L KGL + ++L++E +H H S F LPS+IKA + +Q H + LH L Sbjct: 23 IKSFLSKGLYHQTLQLFSE-LH--LCGHSSISFFLPSVIKASSSAQCH-TFGTQLHCLAL 78 Query: 82 KNGFDSECTVSNSLISHYSKFSD 14 K G SE VSNS+I+ Y KFSD Sbjct: 79 KTGSHSETVVSNSIITMYFKFSD 101 >ref|XP_002867315.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313151|gb|EFH43574.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 598 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 1/92 (1%) Frame = -1 Query: 289 SNLDYYIAN-VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTHKS 113 S L+ + N +K L+ L+ +A++LY ++HP+ + +A ILPS+IKAC+ Q Sbjct: 7 SRLNLELGNKLKGLVSGQLHDEALRLYKLNIHPLGTNGFTA--ILPSVIKACSFQQEPFL 64 Query: 112 LAHLLHSSTLKNGFDSECTVSNSLISHYSKFS 17 L LH K+G D + VSNSLIS Y+K S Sbjct: 65 LGAQLHCLCFKSGADRDTVVSNSLISMYAKLS 96 >sp|O65543.2|PP343_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g31070, mitochondrial; Flags: Precursor Length = 624 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 1/94 (1%) Frame = -1 Query: 295 LLSNLDYYIAN-VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTH 119 L S L+ + N +K L+ +A++LY +H + + +A ILPS+IKACA Q Sbjct: 16 LSSRLNLELGNKLKGLVSDQFYDEALRLYKLKIHSLGTNGFTA--ILPSVIKACAFQQEP 73 Query: 118 KSLAHLLHSSTLKNGFDSECTVSNSLISHYSKFS 17 L LH LK G D + VSNSLIS Y+KFS Sbjct: 74 FLLGAQLHCLCLKAGADCDTVVSNSLISMYAKFS 107 >ref|NP_194836.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|2980759|emb|CAA18186.1| putative protein [Arabidopsis thaliana] gi|7270009|emb|CAB79825.1| putative protein [Arabidopsis thaliana] gi|332660453|gb|AEE85853.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 613 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 1/94 (1%) Frame = -1 Query: 295 LLSNLDYYIAN-VKDLLLKGLNGKAVKLYAEHVHPVFPSHESAVFILPSIIKACAHSQTH 119 L S L+ + N +K L+ +A++LY +H + + +A ILPS+IKACA Q Sbjct: 5 LSSRLNLELGNKLKGLVSDQFYDEALRLYKLKIHSLGTNGFTA--ILPSVIKACAFQQEP 62 Query: 118 KSLAHLLHSSTLKNGFDSECTVSNSLISHYSKFS 17 L LH LK G D + VSNSLIS Y+KFS Sbjct: 63 FLLGAQLHCLCLKAGADCDTVVSNSLISMYAKFS 96