BLASTX nr result
ID: Catharanthus22_contig00041410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00041410 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509986.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002509986.1| conserved hypothetical protein [Ricinus communis] gi|223549885|gb|EEF51373.1| conserved hypothetical protein [Ricinus communis] Length = 584 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/67 (40%), Positives = 38/67 (56%) Frame = -1 Query: 347 GDILPELEKEMXXXXXXXXXXXXXXXXXLEWKMKMEQGINDLESWKATVFTHMDLLDREN 168 GDILP+LEKE+ +EWK M++G+ + ESWK V + MD L REN Sbjct: 483 GDILPDLEKELSRISLLLENRKAELNAVMEWKENMDKGLMNFESWKDDVSSRMDALVREN 542 Query: 167 YLLRFNI 147 +LR ++ Sbjct: 543 IMLRLDV 549