BLASTX nr result
ID: Catharanthus22_contig00041373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00041373 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354388.1| PREDICTED: zinc finger protein ZAT5-like [So... 80 3e-13 dbj|BAA21920.1| ZPT2-11 [Petunia x hybrida] 79 8e-13 gb|ESW34788.1| hypothetical protein PHAVU_001G181200g [Phaseolus... 78 1e-12 ref|XP_002267645.1| PREDICTED: zinc finger protein ZAT5 [Vitis v... 77 2e-12 ref|XP_006493540.1| PREDICTED: zinc finger protein ZAT5-like [Ci... 76 4e-12 ref|XP_006428462.1| hypothetical protein CICLE_v10012395mg [Citr... 76 4e-12 gb|EOY07971.1| Nucleic acid binding protein, putative [Theobroma... 75 7e-12 ref|XP_003554400.1| PREDICTED: zinc finger protein ZAT5-like [Gl... 75 7e-12 ref|XP_004246607.1| PREDICTED: zinc finger protein ZAT5-like [So... 74 2e-11 ref|XP_002519455.1| nucleic acid binding protein, putative [Rici... 74 2e-11 gb|EXB75903.1| Zinc finger protein ZAT5 [Morus notabilis] 73 3e-11 gb|ACU18318.1| unknown [Glycine max] 68 1e-09 ref|XP_002523729.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 emb|CAA43111.1| DNA-binding protein [Petunia x hybrida] 67 3e-09 ref|XP_006384965.1| hypothetical protein POPTR_0004s22650g [Popu... 63 3e-08 ref|XP_004515927.1| PREDICTED: zinc finger protein ZAT5-like [Ci... 63 3e-08 gb|EMJ03632.1| hypothetical protein PRUPE_ppa009872mg [Prunus pe... 63 3e-08 ref|XP_002331457.1| predicted protein [Populus trichocarpa] gi|5... 63 3e-08 gb|ABK95183.1| unknown [Populus trichocarpa] 63 3e-08 ref|XP_002323497.1| hypothetical protein POPTR_0016s10790g [Popu... 63 5e-08 >ref|XP_006354388.1| PREDICTED: zinc finger protein ZAT5-like [Solanum tuberosum] Length = 307 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/57 (68%), Positives = 44/57 (77%) Frame = -2 Query: 235 HEYSSQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 H + Q +RT LSLDLNLPAPED DH E++KF F +KEQVIVFSASPLVDCHY Sbjct: 252 HHHDQQIKNNTRTFLSLDLNLPAPED-DHRPENSKFTFATKEQVIVFSASPLVDCHY 307 >dbj|BAA21920.1| ZPT2-11 [Petunia x hybrida] Length = 282 Score = 78.6 bits (192), Expect = 8e-13 Identities = 41/54 (75%), Positives = 44/54 (81%) Frame = -2 Query: 226 SSQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 SS E+K +R LSLDLNLPAPED DH E+ KF F SKEQVIVFSASPLVDCHY Sbjct: 231 SSHEIKNTRNFLSLDLNLPAPED-DHRPET-KFSFASKEQVIVFSASPLVDCHY 282 >gb|ESW34788.1| hypothetical protein PHAVU_001G181200g [Phaseolus vulgaris] Length = 353 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 217 EVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 E KK + +L+LDLNLPAPED DH+RESN FPF SKE+VIVFSA+ LVDCHY Sbjct: 304 ETKKHKDVLNLDLNLPAPED-DHHRESNLFPFQSKEKVIVFSATSLVDCHY 353 >ref|XP_002267645.1| PREDICTED: zinc finger protein ZAT5 [Vitis vinifera] gi|147788170|emb|CAN64839.1| hypothetical protein VITISV_030377 [Vitis vinifera] Length = 276 Score = 77.0 bits (188), Expect = 2e-12 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = -2 Query: 223 SQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 SQE KK R +L LDLNLPAPED DH RES KFPF +KEQ +VFSASPLVDCHY Sbjct: 227 SQEAKKPRNILQLDLNLPAPED-DH-RES-KFPFATKEQALVFSASPLVDCHY 276 >ref|XP_006493540.1| PREDICTED: zinc finger protein ZAT5-like [Citrus sinensis] Length = 300 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -2 Query: 223 SQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 SQ+ KK R +L LDLNLPAPED +R +KF F SKEQVI+FSASPLVDCHY Sbjct: 251 SQQAKKPRNILQLDLNLPAPED---DRRESKFAFASKEQVIIFSASPLVDCHY 300 >ref|XP_006428462.1| hypothetical protein CICLE_v10012395mg [Citrus clementina] gi|557530519|gb|ESR41702.1| hypothetical protein CICLE_v10012395mg [Citrus clementina] Length = 285 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -2 Query: 223 SQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 SQ+ KK R +L LDLNLPAPED +R +KF F SKEQVI+FSASPLVDCHY Sbjct: 236 SQQAKKPRNILQLDLNLPAPED---DRRESKFAFASKEQVIIFSASPLVDCHY 285 >gb|EOY07971.1| Nucleic acid binding protein, putative [Theobroma cacao] Length = 288 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -2 Query: 223 SQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 SQE KK RT+L LDLNLPAPED DH+RE+ KF F SKE+++VFSAS LVDCHY Sbjct: 238 SQESKKPRTVLQLDLNLPAPED-DHHRET-KFSFASKEKLLVFSASSLVDCHY 288 >ref|XP_003554400.1| PREDICTED: zinc finger protein ZAT5-like [Glycine max] Length = 286 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 217 EVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 E KK + +L+LDLNLPAPED DH RESN FPF +KE+VIVFSA+ LVDCHY Sbjct: 237 EAKKHKDVLNLDLNLPAPED-DHLRESNLFPFQAKEKVIVFSATSLVDCHY 286 >ref|XP_004246607.1| PREDICTED: zinc finger protein ZAT5-like [Solanum lycopersicum] Length = 310 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -2 Query: 235 HEYSSQEVKKS-RTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 H + Q +K + R LSLDLNLPAPED DH E++KF F +KEQVIVFSAS LVDCHY Sbjct: 254 HHHDQQIIKNNTRAFLSLDLNLPAPED-DHRPENSKFTFATKEQVIVFSASSLVDCHY 310 >ref|XP_002519455.1| nucleic acid binding protein, putative [Ricinus communis] gi|223541318|gb|EEF42869.1| nucleic acid binding protein, putative [Ricinus communis] Length = 320 Score = 74.3 bits (181), Expect = 2e-11 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -2 Query: 220 QEVKKSR-TLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 QE KK R L LDLNLPAPEDHD NRES KF F SKEQV+VFS+SPLVDCHY Sbjct: 270 QETKKPRRNSLQLDLNLPAPEDHD-NRES-KFHFASKEQVLVFSSSPLVDCHY 320 >gb|EXB75903.1| Zinc finger protein ZAT5 [Morus notabilis] Length = 303 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -2 Query: 232 EYSSQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 ++ S+E KK R +L LDLNLPA +D +R KFPF SKEQVIVF+ASPLVDCHY Sbjct: 251 DHQSRESKKPRNVLQLDLNLPALDD---DRRETKFPFSSKEQVIVFAASPLVDCHY 303 >gb|ACU18318.1| unknown [Glycine max] Length = 286 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -2 Query: 211 KKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSA-SPLVDCHY 65 K ++ +L+LDLNLPAPED DH+RES FPF +KE+VIVFSA S LVDCHY Sbjct: 238 KHNKDVLNLDLNLPAPED-DHHRESKLFPFQAKEKVIVFSATSSLVDCHY 286 >ref|XP_002523729.1| conserved hypothetical protein [Ricinus communis] gi|223537033|gb|EEF38669.1| conserved hypothetical protein [Ricinus communis] Length = 345 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -2 Query: 226 SSQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASP-LVDCHY 65 S + K RT+LSLDLNLPAPED H+RE KF F + +Q +VFSA+P LVDCHY Sbjct: 292 SDDRIIKPRTILSLDLNLPAPEDDHHHREP-KFQFAATQQALVFSAAPALVDCHY 345 >emb|CAA43111.1| DNA-binding protein [Petunia x hybrida] Length = 281 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = -2 Query: 235 HEYSSQEVK-KSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 H+Y E+K K R +LSLDLNLPAP + DH+ ++ KF F +Q +VFSA+ LVDCHY Sbjct: 226 HDYD--EIKEKPRIILSLDLNLPAPPEDDHHSDNTKFDFSGNKQCLVFSAAALVDCHY 281 >ref|XP_006384965.1| hypothetical protein POPTR_0004s22650g [Populus trichocarpa] gi|550341733|gb|ERP62762.1| hypothetical protein POPTR_0004s22650g [Populus trichocarpa] Length = 308 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -2 Query: 208 KSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 K + +L+LDLNLPAPED H RESN F F S Q +VFSA+ LVDCHY Sbjct: 262 KPKNILALDLNLPAPEDDHHLRESN-FQFTSTRQALVFSATALVDCHY 308 >ref|XP_004515927.1| PREDICTED: zinc finger protein ZAT5-like [Cicer arietinum] Length = 295 Score = 63.2 bits (152), Expect = 3e-08 Identities = 32/54 (59%), Positives = 36/54 (66%) Frame = -2 Query: 226 SSQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 S E KK R +L LDLNLPAPE DH R+ + F F +E VI FS S LVDCHY Sbjct: 243 SHHEAKKPRNVLKLDLNLPAPEV-DHQRDQSTFSFQPRENVIAFSNSSLVDCHY 295 >gb|EMJ03632.1| hypothetical protein PRUPE_ppa009872mg [Prunus persica] Length = 274 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -2 Query: 211 KKSRTLLSLDLNLPAPEDHDHNRESNKFPFG-SKEQVIVFSASPLVDCHY 65 K+ R++L LDLNLPAPE+ R KFPFG KEQVIVFS SPLV CHY Sbjct: 228 KRPRSILQLDLNLPAPEEE---RLETKFPFGPKKEQVIVFSTSPLVGCHY 274 >ref|XP_002331457.1| predicted protein [Populus trichocarpa] gi|566168079|ref|XP_006384966.1| zinc finger family protein [Populus trichocarpa] gi|550341734|gb|ERP62763.1| zinc finger family protein [Populus trichocarpa] Length = 283 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -2 Query: 208 KSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 K + +L+LDLNLPAPED H RESN F F S Q +VFSA+ LVDCHY Sbjct: 237 KPKNILALDLNLPAPEDDHHLRESN-FQFTSTRQALVFSATALVDCHY 283 >gb|ABK95183.1| unknown [Populus trichocarpa] Length = 310 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -2 Query: 208 KSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 K + +L+LDLNLPAPED H RESN F F S Q +VFSA+ LVDCHY Sbjct: 264 KPKNILALDLNLPAPEDDHHLRESN-FQFTSTRQALVFSATALVDCHY 310 >ref|XP_002323497.1| hypothetical protein POPTR_0016s10790g [Populus trichocarpa] gi|222868127|gb|EEF05258.1| hypothetical protein POPTR_0016s10790g [Populus trichocarpa] Length = 295 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = -2 Query: 232 EYSSQEVKKSRTLLSLDLNLPAPEDHDHNRESNKFPFGSKEQVIVFSASPLVDCHY 65 ++ S+E KK R + LDLNLPA ED + +KF F SKEQV+VF+AS LVDCHY Sbjct: 243 DHESEESKKPRDIQLLDLNLPAAED---DLRESKFHFASKEQVLVFTASSLVDCHY 295