BLASTX nr result
ID: Catharanthus22_contig00041240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00041240 (498 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528523.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 >ref|XP_002528523.1| conserved hypothetical protein [Ricinus communis] gi|223532025|gb|EEF33835.1| conserved hypothetical protein [Ricinus communis] Length = 127 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = +1 Query: 244 RGFRLNPRRFSVQKLRSKLLFLLKIFNRFXXXXXXXXXXXXXXXXXXXXXVMAAAQNIDQ 423 RGFRLN +RFSVQ+LR++ ++L K+ +R+ + Sbjct: 22 RGFRLNCKRFSVQRLRARFVYLFKLLSRWKSSYGHAVQSLKRSMSRSSGIKRNTSSRRSL 81 Query: 424 IQK--PDYRLRYYGRSNSFYSEAIADC 498 + + D R+R +GRSNSFYSEAIADC Sbjct: 82 VVEVSSDCRMRTFGRSNSFYSEAIADC 108