BLASTX nr result
ID: Catharanthus22_contig00040936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00040936 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32238.3| unnamed protein product [Vitis vinifera] 64 2e-08 emb|CAN82321.1| hypothetical protein VITISV_021316 [Vitis vinifera] 61 1e-07 >emb|CBI32238.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 471 AEPLKIYLHKYRELEGERSNQNNKTAGNMTIEERDEQSNCRSEPVRRQTVSPTITNFNVT 292 AEPLK YLH+YRELEGE++NQ+ + EE DE SN R EP + TVSP FNV Sbjct: 64 AEPLKRYLHRYRELEGEKANQSKAS------EENDEPSNYRGEPPMKHTVSPAPLKFNVL 117 Query: 291 D 289 + Sbjct: 118 E 118 >emb|CAN82321.1| hypothetical protein VITISV_021316 [Vitis vinifera] Length = 175 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = -2 Query: 471 AEPLKIYLHKYRELEGERSNQNNKTAGNMTIEERDEQSNCRSEPVRRQTVSPTITNFNVT 292 AEPLK YLH+YRELEGE++NQ+ + EE DE SN R EP + TVS FNV Sbjct: 111 AEPLKRYLHRYRELEGEKANQSKAS------EENDEPSNYRGEPPMKHTVSXAPLKFNVL 164 Query: 291 D 289 + Sbjct: 165 E 165