BLASTX nr result
ID: Catharanthus22_contig00040765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00040765 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC29358.1| hypothetical protein L484_021666 [Morus notabilis] 57 3e-06 >gb|EXC29358.1| hypothetical protein L484_021666 [Morus notabilis] Length = 447 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 282 KLQLVVDSLLLIHALVTNEKADIAISTHPFYVH 184 KLQL+VD LLLIHALV ++KAD+AIS HPFYVH Sbjct: 260 KLQLMVDPLLLIHALVVSQKADVAISKHPFYVH 292